spacer

EBI Dbfetch

ID   AB207269; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AB207269;
XX
DT   22-MAR-2005 (Rel. 83, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class2 antigen, partial
DE   cds,allele:HLA-DRB1*09012V.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Hisayama Y., Funatuki Y., Hashimoto M.;
RT   ;
RL   Submitted (17-MAR-2005) to the INSDC.
RL   Yoshifumi Hisayama, Osaka General Medical Center, HLA Labolatory;
RL   Sumiyoshiku-Mandai-Higashi 3-1-56, Osaka, 558-8558, Japan
RL   (E-mail:osaka_hla@gh.pref.osaka.jp, Tel:81666923601, Fax:81666923601)
XX
RN   [2]
RA   Hisayama Y., Funatuki Y., Hashimoto M.;
RT   "Homo sapiens HLA-DR gene for MHC class2 antigen,partial
RT   cds,allele:HLA-DRB1*09012V";
RL   Unpublished.
XX
DR   MD5; db9076a1cbbb39b0820e3858a8d91b22.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="HLA A*24/*33,B*1511/*44,Cw*03/*14,DRB1*09012V/
FT                   *08032,DQB1*0601/*0303"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*09012V"
FT                   /product="MHC class2 antigen"
FT                   /db_xref="GOA:Q59HP9"
FT                   /db_xref="IMGT/HLA:DRB1*09:05"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q59HP9"
FT                   /protein_id="BAD91204.1"
FT                   /translation="RFLKQDKFECHFFNGTERVRYLHRGIYNQEENVRFDSDVGEYRAV
FT                   TELGRPVAESWNSQKDFLERRRAEVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 61 A; 62 C; 100 G; 47 T; 0 other;
     cacgtttctt gaagcaggat aagtttgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggtatctgca cagaggcatc tataaccaag aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacttcct ggagcggagg cgggccgagg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagaggcgag                                        270
//


spacer
spacer