Dbfetch

ID   AB197051; SV 1; linear; genomic DNA; STD; HUM; 1001 BP.
XX
AC   AB197051;
XX
DT   24-DEC-2004 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, partial cds,
DE   allele:HLA-B*5401N1.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1001
RA   Kashiwase K., Ichihara T., Shimizu M., Satake M.;
RT   ;
RL   Submitted (21-DEC-2004) to the INSDC.
RL   Kouichi Kashiwase, Tokyo Red Cross Blood Center, Research; Hiroo 4-1-31,
RL   Shibuya-ku, Tokyo, 150-0012, Japan (E-mail:ko-kashiwase@tokyo.bc.jrc.or.jp,
RL   Tel:81-3-3406-1211, Fax:81-3-3406-7892)
XX
RN   [2]
RA   Kashiwase K., Ichihara T., Shimizu M., Satake M.;
RT   "HLA-B*5401N1";
RL   Unpublished.
XX
DR   MD5; 2f54a539646b499821d678296c9d835b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1001
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A*2402/3101,B*5401N1/3501,Cw*0102/0401,
FT                   DRB1*0803/0901,TBC49946"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..249,350..625,726..>1001)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5401N1"
FT                   /product="MHC class I antigen"
FT                   /note="null allele"
FT                   /db_xref="IMGT/HLA:B*54:05N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q5NT47"
FT                   /protein_id="BAD82817.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   QEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTWQTMYGCDLGPDGRLLRG
FT                   HNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTCVEWLRRY
FT                   LENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTEL
FT                   VETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   gap             250..349
FT                   /estimated_length=unknown
FT   gap             626..725
FT                   /estimated_length=unknown
XX
SQ   Sequence 1001 BP; 175 A; 247 C; 268 G; 111 T; 200 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagcag gaggggccgg agtattggga ccggaacaca cagatctaca       180
     aggcccaggc acagactgac cgagagagcc tgcggaacct gcgcggctac tacaaccaga       240
     gcgaggccgn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnng gtctcacact       360
     tggcagacga tgtatggctg cgacctgggg ccggacgggc gcctcctccg cgggcataac       420
     cagttagcct acgacggcaa ggattacatc gccctgaacg aggacctgag ctcctggacc       480
     gcggcggaca ccgcggctca gatcacccag cgcaagtggg aggcggcccg tgtggcggag       540
     cagctgagag cctacctgga gggcacgtgc gtggagtggc tccgcagata cctggagaac       600
     gggaaggaga cgctgcagcg cgcggnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnacccc ccaaagacac acgtgaccca ccaccccatc tctgaccatg aggccaccct       780
     gaggtgctgg gccctgggct tctaccctgc ggagatcaca ctgacctggc agcgggatgg       840
     cgaggaccaa actcaggaca ctgagcttgt ggagaccaga ccagcaggag atagaacctt       900
     ccagaagtgg gcagctgtgg tggtgccttc tggagaagag cagagataca catgccatgt       960
     acagcatgag gggctgccga agcccctcac cctgagatgg g                          1001
//