spacer

EBI Dbfetch

ID   AB196528; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AB196528;
XX
DT   15-DEC-2004 (Rel. 82, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class 2 antigen, partial cds,
DE   alele:HLA-DRB1*0403V1.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Kashiwase K., Ichihara T., Shimizu M., Satake M.;
RT   ;
RL   Submitted (13-DEC-2004) to the INSDC.
RL   Kouichi Kashiwase, Tokyo Red Cross Blood Center, Research; Hiroo 4-1-31,
RL   Shibuya-ku, Tokyo, 150-0012, Japan (E-mail:ko-kashiwase@tokyo.bc.jrc.or.jp,
RL   Tel:81-3-3406-1211, Fax:81-3-3406-7892)
XX
RN   [2]
RA   Kashiwase K., Ichihara T., Shimizu M., Satake M.;
RT   "HLA-DRB1";
RL   Unpublished.
XX
DR   MD5; 24f9446b4259c960a80bc3f95caf2c23.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A*2402/-,B*3902/4002,Cw*0303/0702,DRB1*0403V1/
FT                   0802,TBC50414"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0403V1"
FT                   /product="MHC class 2 antigen"
FT                   /db_xref="GOA:Q5NT90"
FT                   /db_xref="IMGT/HLA:DRB1*04:52"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q5NT90"
FT                   /protein_id="BAD80735.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAEVDTYCRHNYGVVERFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0403V1"
FT                   /number=2
XX
SQ   Sequence 270 BP; 61 A; 63 C; 98 G; 48 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgagg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag attcacagtg cagcggcgag                                        270
//


spacer
spacer