spacer

EBI Dbfetch

ID   AB176923; SV 1; linear; genomic DNA; STD; HUM; 645 BP.
XX
AC   AB176923;
XX
DT   19-APR-2004 (Rel. 79, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-B gene for MHC class 1 antigen, exon 2 and 3, partial cds,
DE   allele:HLA-B*58null.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-645
RA   Kashiwagi S., Sato H., Tokunaga K., Arazoe S., Oyama M., Yoshitake K.,
RA   Aritake H., Uchida J., Yamaguchi E., Terumoto Y.;
RT   ;
RL   Submitted (13-APR-2004) to the INSDC.
RL   Etsuko Yamaguchi, Fukuoka Red Cross Blood Center, 2nd Laboratory Sect.;
RL   1-2-1,kamikoga, Chikushino-shi, Fukuoka 818-8588, Japan
RL   (E-mail:fbc.test@fukuoka.email.ne.jp, Tel:81-92-921-1408,
RL   Fax:81-92-921-1407)
XX
RN   [2]
RA   Kashiwagi S., Sato H., Tokunaga K., Arazoe S., Oyama M., Yoshitake K.,
RA   Aritake H., Uchida J., Yamaguchi E., Terumoto Y.;
RT   "HLA-B58null Submission";
RL   Unpublished.
XX
DR   MD5; f079c5b28ffa6138ef234a1905022114.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..645
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /serotype="A24/33,B54/58null,Cw1/Cw10"
FT                   /mol_type="genomic DNA"
FT                   /country="Japan:Fukuoka"
FT                   /haplotype="A33-B58null-Cw10"
FT                   /note="family typing"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>645)
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*58null"
FT                   /product="MHC class 1 antigen"
FT                   /db_xref="GOA:Q75ND3"
FT                   /db_xref="IMGT/HLA:B*58:10N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q75ND3"
FT                   /protein_id="BAD16610.1"
FT                   /translation="LPLHEVFLHRHVPARPRGAPLHRSGLRGRHPVREVRQRRRESEDG
FT                   APGAMDRAGGAGVLGRGDTEHEGLRADLPREPADRAPLLQPERGRVSHHPEDYGCDLGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*58null"
FT                   /product="MHC class 1 antigen"
FT                   /number=2
FT                   /note="50-84786,HLA-B*58null"
FT   misc_feature    271..370
FT                   /note="estimated length gap (unknown)"
FT                   /note="intron"
FT   exon            371..645
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*58null"
FT                   /product="MHC class 1 antigen"
FT                   /number=3
FT                   /note="50-84786,HLA-B*58null"
XX
SQ   Sequence 645 BP; 107 A; 173 C; 192 G; 73 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     acggggagac acggaacatg aaggcctccg cgcagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacat catccagagg attatggctg cgacctgggg cccgacgggc       420
     gcctcctccg cgggcatgac cagtccgcct acgacggcaa ggattacatc gccctgaacg       480
     aggacctgag ctcctggacc gcggcggaca ccgcggctca gatcacccag cgcaagtggg       540
     aggcggcccg tgtggcggag cagctgagag cctacctgga gggcctgtgc gtggagtggc       600
     tccgcagata cctggagaac gggaaggaga cgctgcagcg cgcgg                       645
//


spacer
spacer