spacer

EBI Dbfetch

ID   AB176445; SV 1; linear; genomic DNA; STD; HUM; 342 BP.
XX
AC   AB176445;
XX
DT   06-APR-2004 (Rel. 79, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, exon 2, partial cds,
DE   allele:HLA-DRB1*1502V2.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-342
RA   Kashiwase K., Shimizu M., Satake M.;
RT   ;
RL   Submitted (02-APR-2004) to the INSDC.
RL   Kouichi Kashiwase, Tokyo Red Cross Blood Center, Research; Hiroo 4-1-31,
RL   Shibuya-ku, Tokyo 150-0012, Japan (E-mail:ko-kashiwase@tokyo.bc.jrc.or.jp,
RL   Tel:81-3-3406-1211, Fax:81-3-3406-7892)
XX
RN   [2]
RA   Kashiwase K., Shimizu M., Satake M.;
RT   "HLA-DRB1*1502V2";
RL   Unpublished.
XX
DR   MD5; 247e3d3210c42026b3138da8693941b9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..342
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A*2402/2420,B*3501/5201,DRB1*1101/1502V2,
FT                   TBC44279"
FT                   /db_xref="taxon:9606"
FT   CDS             <34..>303
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1502V2"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q75NJ4"
FT                   /db_xref="IMGT/HLA:DRB1*15:15"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q75NJ4"
FT                   /protein_id="BAD15071.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDFLEQARAAVDTYCRHNYGVGESFTVQRR"
FT   exon            34..303
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1502V2"
FT                   /number=2
XX
SQ   Sequence 342 BP; 62 A; 90 C; 129 G; 61 T; 0 other;
     cgccctgtga ccggatggtt cgtgtcccca cagcacgttt cctgtggcag cctaagaggg        60
     agtgtcattt cttcaatggg acggagcggg tgcggttcct ggacagatac ttctataacc       120
     aggaggagtc cgtgcgcttc gacagcgacg tgggggagtt ccgggcggtg acggagctgg       180
     ggcggcctga cgctgagtac tggaacagcc agaaggactt cctggagcag gcgcgggccg       240
     cggtggacac ctactgcaga cacaactacg gggttggtga gagcttcaca gtgcagcggc       300
     gaggtgagca tggccgcggg cggggcctga gtccccgtga gc                          342
//


spacer
spacer