Dbfetch

ID   AB112912; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AB112912;
XX
DT   04-DEC-2003 (Rel. 78, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, partial cds,
DE   country:Japan:Hyougo, sex:female.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Ono A., Isii H., Ikeda M., Fukumori Y., Araki N., Nose G.;
RT   ;
RL   Submitted (20-JUN-2003) to the INSDC.
RL   Akiko Ono, Osaka Red Cross Blood Center; 2-4-43,Morinomiya,Joto-ku;, Osaka,
RL   Osaka 536-8505, Japan (E-mail:ono@osaka.bc.jrc.or.jp,
RL   Tel:81-06-6962-7698(ex.416), Fax:81-06-6962-7394)
XX
RN   [2]
RA   Ono A.;
RT   "A new HLA-DR12V allele detected by PCR-RFLP";
RL   Unpublished.
XX
DR   MD5; 86b1f06a7c2e514a44cbe392698557b3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /country="Japan:Hyougo"
FT                   /sex="female"
FT                   /cell_type="leukocyte"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q768U3"
FT                   /db_xref="IMGT/HLA:DRB1*14:03:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q768U3"
FT                   /protein_id="BAD02943.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEDRRALVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 58 A; 64 C; 97 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga gagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtatcg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//