spacer

EBI Dbfetch

ID   AB106129; SV 1; linear; genomic DNA; STD; HUM; 343 BP.
XX
AC   AB106129;
XX
DT   20-MAR-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, partial cds,
DE   allele:HLA-DRB1*1101V1.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-343
RA   Kashiwase K., Shimizu M., Satake M.;
RT   ;
RL   Submitted (17-MAR-2003) to the INSDC.
RL   Koichi Kashiwase, Japanese Red Cross Tokyo Metropolitan Blood Center,
RL   Laboratory; Hiroo 4-1-31, Shibuya, Tokyo 150-0012, Japan
RL   (E-mail:ko-kashiwase@tokyo.bc.jrc.or.jp, Tel:81-3406-1211)
XX
RN   [2]
RA   Kashiwase K.;
RT   "HLA-DRB1 new alleles  DNA Sequence";
RL   Unpublished.
XX
DR   MD5; d51314d338b450fc204957a8ec06a51d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..343
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="TBC-33607 HLA-DRB1*1101V1 was detected from an
FT                   individual with the genotype A*0207/310102, B*4002/4601,
FT                   DRB1*1101V1/0803"
FT                   /db_xref="taxon:9606"
FT   intron          <1..34
FT                   /number=1
FT   CDS             <35..>304
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1101V1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q860S7"
FT                   /db_xref="IMGT/HLA:DRB1*11:01:05"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q860S7"
FT                   /protein_id="BAC66088.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDEEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            35..304
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   intron          305..>343
FT                   /number=2
XX
SQ   Sequence 343 BP; 65 A; 83 C; 127 G; 68 T; 0 other;
     cgcctgtgtg actggatcgt tcgtgtcccc acagcacgtt tcttggagta ctctacgtct        60
     gagtgtcatt tcttcaatgg gacggagcgg gtgcggttcc tggacagata cttctataac       120
     caagaggagt acgtgcgctt cgacagcgac gtgggggagt tccgggcggt gacggagctg       180
     gggcggcctg atgaggagta ctggaacagc cagaaggact tcctggaaga caggcgggcc       240
     gcggtggaca cctattgcag acacaactac ggggttggtg agagcttcac agtgcagcgg       300
     cgaggtgagc gcggcgcggg gcggggcctg agtccctgtg agc                         343
//


spacer
spacer