Dbfetch

ID   AB106128; SV 1; linear; genomic DNA; STD; HUM; 343 BP.
XX
AC   AB106128;
XX
DT   20-MAR-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, partial cds,
DE   allele:HLA-DRB1*0406V1.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-343
RA   Kashiwase K., Shimizu M., Satake M.;
RT   ;
RL   Submitted (17-MAR-2003) to the INSDC.
RL   Koichi Kashiwase, Japanese Red Cross Tokyo Metropolitan Blood Center,
RL   Laboratory; Hiroo 4-1-31, Shibuya, Tokyo 150-0012, Japan
RL   (E-mail:ko-kashiwase@tokyo.bc.jrc.or.jp, Tel:81-3406-1211)
XX
RN   [2]
RA   Kashiwase K.;
RT   "HLA-DRB1 new alleles  DNA Sequence";
RL   Unpublished.
XX
DR   MD5; 6831d9dd6c4ffa26266805cb5612b9f4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..343
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="TBC-22381 HLA-DRB1*0406V1 was detected from an
FT                   individual with the genotype  HLA-A*24020101/310102,
FT                   B*070201/15010101, DRB1*0406V1/1502"
FT                   /db_xref="taxon:9606"
FT   intron          <1..34
FT                   /number=1
FT   CDS             <35..>304
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0406V1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q860S8"
FT                   /db_xref="IMGT/HLA:DRB1*04:46"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q860S8"
FT                   /protein_id="BAC66087.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEESVRFDSDVGEYRAV
FT                   TELGRADAEYWNSQKDLLEQRRAEVDTYCRHNYGVVESFTVQRR"
FT   exon            35..304
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   intron          305..>343
FT                   /number=2
XX
SQ   Sequence 343 BP; 66 A; 88 C; 126 G; 63 T; 0 other;
     cgcttctgta accggatcgt tcttgtcccc ccagcacgtt tcttggagca ggttaaacat        60
     gagtgtcatt tcttcaacgg gacggagcgg gtgcggttcc tggacagata cttctatcac       120
     caagaggagt ccgtgcgctt cgacagcgac gtgggggagt accgggcggt gacggagctg       180
     gggcgggctg atgccgagta ctggaacagc cagaaggacc tcctggagca gaggcgggcc       240
     gaggtggaca cctactgcag acacaactac ggggttgtgg agagcttcac agtgcagcgg       300
     cgaggtgagc gcggcgcggg gcggggcctg agtccctgtg agc                         343
//