spacer

EBI Dbfetch

ID   AB106127; SV 1; linear; genomic DNA; STD; HUM; 342 BP.
XX
AC   AB106127;
XX
DT   20-MAR-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-DRB1 gene for MHC class II antigen, partial cds,
DE   allele:HLA-DRB1*1501V2.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-342
RA   Kashiwase K., Shimizu M., Satake M.;
RT   ;
RL   Submitted (17-MAR-2003) to the INSDC.
RL   Koichi Kashiwase, Japanese Red Cross Tokyo Metropolitan Blood Center,
RL   Laboratory; Hiroo 4-1-31, Shibuya, Tokyo 150-0012, Japan
RL   (E-mail:ko-kashiwase@tokyo.bc.jrc.or.jp, Tel:81-3406-1211)
XX
RN   [2]
RA   Kashiwase K.;
RT   "HLA-DRB1 new alleles  DNA Sequence";
RL   Unpublished.
XX
DR   MD5; f3645ea5d43d5ed3cf9fff211538d420.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   Ensembl-Tr; ENST00000611060; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..342
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="TBC-B23250 HLA-DRB1*150101V2 was detected from an
FT                   individual with the genotype HLA-A*0206/110101,
FT                   B*15010101/5401, DRB1*150101V2/1403"
FT                   /db_xref="taxon:9606"
FT   intron          <1..33
FT                   /number=1
FT   CDS             <34..>303
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1501V2"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q860S9"
FT                   /db_xref="IMGT/HLA:DRB1*15:01:05"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q860S9"
FT                   /protein_id="BAC66086.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRR"
FT   exon            34..303
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   intron          304..>342
FT                   /number=2
XX
SQ   Sequence 342 BP; 63 A; 91 C; 128 G; 60 T; 0 other;
     cgccctgtga ccggatggtt cgtgtcccca cagcacgttt cctgtggcag cctaagaggg        60
     agtgtcattt cttcaatggg accgagcggg tgcggttcct ggacagatac ttctataacc       120
     aggaggagtc cgtgcgcttc gacagcgacg tgggggagtt ccgggcggtg acggagctgg       180
     ggcggcctga cgctgagtac tggaacagcc agaaggacat cctggagcag gcgcgggccg       240
     cggtggacac ctactgcaga cacaactacg gggttgtgga gagcttcaca gtgcagcggc       300
     gaggtgagca tggccgcggg cggggcctga gtccccgtga gc                          342
//


spacer
spacer