Dbfetch

ID   AB103613; SV 1; linear; genomic DNA; STD; HUM; 6097 BP.
XX
AC   AB103613;
XX
DT   13-SEP-2006 (Rel. 89, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Homo sapiens gene for MICB protein, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-6097
RA   Shiina T.;
RT   ;
RL   Submitted (19-FEB-2003) to the INSDC.
RL   Takashi Shiina, Tokai University School of Medicine, Molecular Life Sciense
RL   2; Bohseidai, Isehara, Kanagawa 259-1193, Japan
RL   (E-mail:tshiina@is.icc.u-tokai.ac.jp, Tel:81-463-93-1121,
RL   Fax:81-463-94-8884)
XX
RN   [2]
RX   DOI; 10.1534/genetics.106.057034.
RX   PUBMED; 16702430.
RA   Shiina T., Ota M., Shimizu S., Katsuyama Y., Hashimoto N., Takasu M.,
RA   Anzai T., Kulski J.K., Kikkawa E., Naruse T., Kimura N., Yanagiya K.,
RA   Watanabe A., Hosomichi K., Kohara S., Iwamoto C., Umehara Y., Meyer A.,
RA   Wanner V., Sano K., Macquin C., Ikeo K., Tokunaga K., Gojobori T.,
RA   Inoko H., Bahram S.;
RT   "Rapid evolution of major histocompatibility complex class I genes in
RT   primates generates new disease alleles in humans via hitchhiking
RT   diversity";
RL   Genetics 173(3):1555-1570(2006).
XX
DR   MD5; 2d5071480754d57902fe3d28c8a11e3a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6097
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="AKIBA"
FT                   /cell_type="B cell"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<559..813,1085..1372,1964..2242,2342..2473,4724..4851)
FT                   /codon_start=3
FT                   /gene="MICB"
FT                   /product="MICB protein"
FT                   /note="stress inducible class I homologue, gamma delta-TCR
FT                   and NKG2D ligand"
FT                   /db_xref="IMGT/HLA:MICB*005:03"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q0EFB4"
FT                   /protein_id="BAF31274.1"
FT                   /translation="PHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQ
FT                   GQWAEDVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSSTR
FT                   GSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADC
FT                   LQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSL
FT                   SHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKALVLQS
FT                   QRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQ
FT                   LGFQPLMSATGSTGSTEGA"
FT   exon            559..813
FT                   /gene="MICB"
FT                   /number=2
FT   exon            1085..1372
FT                   /gene="MICB"
FT                   /number=3
FT   exon            1964..2242
FT                   /gene="MICB"
FT                   /number=4
FT   exon            2342..2473
FT                   /gene="MICB"
FT                   /number=5
FT   exon            4724..6061
FT                   /gene="MICB"
FT                   /number=6
XX
SQ   Sequence 6097 BP; 1306 A; 1599 C; 1710 G; 1482 T; 0 other;
     gggatactga ccccactata aacttcactg gggctacaac cttcctaccc cttgtgcctc        60
     atgaccaccc cctcccttgt ccccaccatg cccatgatga gtcttttctc aaggcagctc       120
     gccttgcctc catctcaccc tcacctgtgc accacagcca cactggacat gggtccctct       180
     gagcctgagt cccttcccat tcccactgtc ccctctggca agaccttcct tccaacactg       240
     ccttcatgct cctcccttgc ccctgcaggg cagcctctcc ccttggcccc tattccctta       300
     gggggcttgt ggccacccag tcctggcacc tgacctacaa gtttgccatc ttcattcccc       360
     cttcttctgt tcatcagccc cctcctctat cctcccaccc tcacagtttt ccttgtatat       420
     gaaatcttcg ttcttgtcct tttgcccatg tgcatttcct gcctcctcag ggaggtcggg       480
     acagcagacc tgtgtgttaa acatcaatgt gaagttattt ccaggaagaa gtttcacctg       540
     tgatttcctc ttccccagag ccccacagtc ttcgttacaa cctcatggtg ctgtcccagg       600
     atggatctgt gcagtcaggg tttctcgctg agggacatct ggatggtcag cccttcctgc       660
     gctatgacag gcagaaacgc agggcaaagc cccagggaca gtgggcagaa gatgtcctgg       720
     gagctaagac ctgggacaca gagaccgagg acttgacaga gaatgggcaa gacctcagga       780
     ggaccctgac tcatatcaag gaccagaaag gaggtgagag tcggcagggg caagagtaat       840
     gggaggcctt ctccaggaaa gttggagaca gagagcaggg acctgtctct tcccgctgga       900
     tctggctggg ggtggggatg aggaataggg tcagggaggc tcagcagggt ggtgagccgg       960
     aactcagccc acacagggag gcatggagga gggccaggga ggggtcgccg ctgggctgag      1020
     ttcctcactt gggtggaaag gtgatgggtt cgggaatgga gaagtcactg ctgggtgggg      1080
     gcaggcttgc attccctcca ggagattagg gtctgtgaga tccatgaaga cagcagcacc      1140
     aggggctccc ggcatttcta ctacgatggg gagctcttcc tctcccaaaa cctggagact      1200
     caagaatcga cagtgcccca gtcctccaga gctcagacct tggctatgaa cgtcacaaat      1260
     ttctggaagg aagatgccat gaagaccaag acacactatc gcgctatgca ggcagactgc      1320
     ctgcagaaac tacagcgata tctgaaatcc ggggtggcca tcaggagaac aggtaccgac      1380
     cctggccagg ggctctactg ttcccgcaat tctgctagag ttgcctcgcc tcccagctct      1440
     gtccggggaa accctccctg tgctatggat gcaggcgttt cctgttggca tattgtgtcc      1500
     tgatttgcct ctcctgttag agccattgga taaagacagt gggtctggga ctgaactgtc      1560
     cagtgttgta atctgggaaa gcagtgggcc ctctgacaga agcctgagcc tggggtggga      1620
     gttaggcagg agaggaagcc ctcagggcca gggctgcccc ctctgcctcc cggcctgccc      1680
     atcccggaga gttccctcct ggccccatga cccaggagtc cacccttgac atccccctcc      1740
     tcagcatcaa tgtggggatc ccagagcctg aggccacagt cccaaggccc atcctcctgc      1800
     tagcctggag gaattaggcc ccagggtgag gacagactta cagaaggtcc gggatctgtg      1860
     agggattcag ccagagtgag aacagtggag aggagcagcc ctgttccctg catctccctt      1920
     agaggggagc agggcttcac tggctctgcc ctttcttctc cagtgccccc catggtgaat      1980
     gtcacctgca gcgaggtctc agagggcaac atcaccgtga catgcagggc ttccagcttc      2040
     tatccccgaa atatcacact gacctggcgt caggatgggg tatctttgag ccacaacacc      2100
     cagcagtggg gggatgtcct gcctgatggg aatggaacct accagacctg ggtggccacc      2160
     aggattcgcc aaggagagga gcagaggttc acctgctaca tggaacacag cgggaatcac      2220
     ggcactcacc ctgtgccctc tggtgagcct ggggtgaccc tggagagggt caggccaggg      2280
     taggaacagc agggacggct gtggctctct gcccagtgta taacaagtcc ctttttttca      2340
     gggaaggcgc tggtgcttca gagtcaacgg acagactttc catatgtttc tgctgctatg      2400
     ccatgttttg ttattattat tattctctgt gtcccttgtt gcaagaagaa aacatcagcg      2460
     gcagagggtc caggtgagaa aaggggacag tttctggaga tgggaaagct cctttctagg      2520
     cagtagggtc tcctcattgc tcctgcccag acaagacgta ggtgacaagg ctgctggaac      2580
     aggggatgga agctggggta tttgggaggg gaatgggagc tgcatctcca tctacaccca      2640
     taagtgcttc tcaagccagg gctggggcaa ggccttcgaa tatccagctg tggcctcctc      2700
     ctgctgcaag tgaggagtgg gcagcaggga gggctgtggc acctgctctg tccccatccc      2760
     agcctctctg tctctcgggc tcactagggt gcgtccaggt ggggtgagtt gggaatcacg      2820
     tgctgattgc tgagggcctg gatgatcatg gtgtcagagg gaggaaatag taaaggtggc      2880
     tgtgatctgg ggagggccag aaactggaga ggaatccaag gagaggcggt gcccacccgt      2940
     gtgcctcctc caggaggcac tttccaggtt cccaccacct ggcctccctg agtttccttg      3000
     cagatgacac agatgaatag ataagcagat gtccctgggc catttgagga gcggggccca      3060
     gcccctcatc agggcagatg tggtccctgt tttcatccta cctccagcgt gttttcttct      3120
     gcagtccctg agggacacag tccccaggcg ccatctcttt gaggctttgt tctgtgctct      3180
     gtggccttac cttgccctcc ctgagccaat ttccctttct caaggtggtc actgcctggt      3240
     aagtttggag taagggacgg tcagaagcat ttcccccaca gtcaggttgt ttgatggggg      3300
     atgaaaagag acagcagaag ttttgtgttt ctgcaaaaac agaggcagtg caggggacag      3360
     tgagaggctg gggtgtccag gagacctgag tctggcggta ggggcgctgg tttctcatcc      3420
     ttgaacctaa ttgcactgtc agtcggcccc tcatgcctga gcagatggga aggttcgtcc      3480
     cctgccctgc agcaagaggg ccctgtccag gaggcaccca cagcaggggc agtgcaggtc      3540
     tgtggtcact cctgctctca cctgcggcgt ctcccgtgga gggattgtca cttctggttc      3600
     cctgtgggca ggaatggttt cctcgtaggt cactggggtt ttggccagga aaagggtatg      3660
     aaattcatgt gccagtttat caaaattcct gctttcaatg ttgatgtcca ataaagatgt      3720
     tcgtaatttc agctctataa tcttaatagg atttcctcta atactgctgt tgtaaagcat      3780
     attaaataaa acaggaactc aaatttggag ccccctctcc agaagggtct gtgtggagat      3840
     ggtggctgtg gcagcggcag ttcccaggtg cagagggtgg gcagaggcag cctcaggcta      3900
     aggggtctcc cctactccac gtggagaaaa gtccttgtag gttgcaaggg cagtggcctg      3960
     ggtggaatcc ctgctaggga cagagcagga aggcctcgca gcctcaccaa gcagcagctc      4020
     tggggtgaag taagtggacc aggagtaagt ggaccaggca ggagcagtag tgactcaaca      4080
     gcaggtcaca ggcctaggtg ggtgctgaag gtcatgggag gccaggcctc ctcgagcaag      4140
     gtggggggtc ccagggtcat gtcaggtgca gatcctgtgg cagccatgtc tttccatgct      4200
     gggcctgctg ggccccccag gcttcctgat ggggtcccca gttaggagct gcctgctcag      4260
     ggctgggagg ggaggagtgc tgagctgcag atagagggca gggcccacag tgggcagggc      4320
     ctgccctggt gtgcaggtgc ctctgcagga gaggagggcc tggggactga gagcaagggt      4380
     cagggcctct ctttggggag gcctctcact gtaacaggac tggtcaggcc tgagaggagg      4440
     gcactgggtt ccctcttggg tcttgtcctt ttgtcttggg gccctttcac tccctgcacg      4500
     gtgagtggtg ggcacaggac aggggctgat gttgatggag tgatgggaga gaactgacag      4560
     gggctgggaa aagcaaggag ggaggaagaa aaaagtgggg gcctcatctt ctctcagaga      4620
     aagggtgaat ctgattttgg ggcaactgaa gagagaaaag tccttaggga ataaacacaa      4680
     cactgcaccc agtggagcat ttacccgttt ccctcttctc cagagcttgt gagcctgcag      4740
     gtcctggatc aacacccagt tgggacagga gaccacaggg atgcagcaca gctgggattt      4800
     cagcctctga tgtcagctac tgggtccact ggttccactg agggcgccta gactctacag      4860
     ccaggcggcc aggattcaac tccctgcctg gatctcacca gcactttccc tctgtttcct      4920
     gacctatgaa acagaaaata acatcactta tttattgttg ttggatgctg caaagtgtta      4980
     gtaggtatga ggtgtttgct gctctgccac gtagagagcc agcaaaggga tcatgaccaa      5040
     ctcaacattc cattggaggc tatatgatca aacagcaaat tgtttatcat gaatgcagga      5100
     tgtgggcaaa ctcacgactg ctcctgccaa cagaaggttt gctgagggca ttcactccat      5160
     ggtgctcatt ggagttatct actgggtcat ctagagccta ttgtttgagg aatgcagtct      5220
     tacaagccta ctctggaccc agcagctgac tccttcttcc acccctcttc ttgctatctc      5280
     ctataccaat aaatacgaag ggctgtggaa gatcagagcc cttgttcacg agaagcaaga      5340
     agccccctga ccccttgttc caaatatact cttttgtctt tctctttatt cccacgttcg      5400
     ccctttgttc agtccaatac agggttgtgg ggcccttaac agtgccatat taattggtat      5460
     cattatttct gttgtttttg tttttgtttt tgtttttgtt tttgagacag agtctcactc      5520
     tgtcacccag gctgcagttc actggtgtga tctcagctca ctgcaacctc tgcctcccag      5580
     gttcaagcac ttctcgtacc tcagactccc gaatagctgg gattacagac aggcaccacc      5640
     acacccagct aatttttgta ttttttgtag agacggggtt tcgccaagtt gaccagccca      5700
     gtttcaaact cctgacctca ggtgatctgc ctgccttggc atcccaaagt gctgggatta      5760
     caagaatgag ccaccgtgcc tggcctattt tattatattg taatatattt tattatatta      5820
     gccaccatgc ctgtcctatt ttcttatgtt ttaatatatt ttaatatatt acatgtgcag      5880
     taattagatt atcatgggtg aactttatga gtgagtatct tggtgatgac tcctcctgac      5940
     cagcccagga ccagctttct tgtcaccttg aggtcccctc gccccgtcac accgttatgc      6000
     attactctgt gtctactatt atgtgtgcat aatttatacc gtaaatgttt actctttaaa      6060
     tagacatttc tggtctgtgt tttatttcat gcgtctg                               6097
//