spacer

EBI Dbfetch

ID   AB091216; SV 1; linear; genomic DNA; STD; HUM; 3153 BP.
XX
AC   AB091216;
XX
DT   06-SEP-2002 (Rel. 73, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, complete cds,
DE   allele:HLA-B*39011 null.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3153
RA   Kashiwase K., Ogawa A., Satake M.;
RT   ;
RL   Submitted (02-SEP-2002) to the INSDC.
RL   Koichi Kashiwase, Japanese Red Cross Tokyo Metropolitan Blood Center; Hiroo
RL   4-1-31, Shibuya 150-0012, Japan (E-mail:ko-kashiwase@tokyo.bc.jrc.or.jp,
RL   Tel:81-3-3406-1211, Fax:81-3-3406-7892)
XX
RN   [2]
RA   Kashiwase K.;
RT   "Homo Sapiens DNA for HLA-B*39011 null";
RL   Unpublished.
XX
DR   Ensembl-Gn; ENSG00000223532; homo_sapiens.
DR   Ensembl-Tr; ENST00000425848; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3153
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   promoter        1..282
FT                   /gene="HLA-B"
FT                   /note="allele:HLA-B*39011 null"
FT   CDS             join(283..355,484..753,1000..1275,1848..2123,2217..2333,
FT                   2775..2807,2914..2957)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39011 null"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:P30475"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*39:01:01:02L"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30475"
FT                   /protein_id="BAC11810.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTDRESLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRTYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            283..355
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39011 null"
FT                   /product="MHC class I antigen"
FT                   /number=1
FT   intron          356..483
FT   exon            484..753
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39011 null"
FT                   /product="MHC class I antigen"
FT                   /number=2
FT   intron          754..999
FT   exon            1000..1275
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39011 null"
FT                   /product="MHC class I antigen"
FT                   /number=3
FT   intron          1276..1847
FT   exon            1848..2123
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39011 null"
FT                   /product="MHC class I antigen"
FT                   /number=4
FT   intron          2124..2216
FT   exon            2217..2333
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39011 null"
FT                   /product="MHC class I antigen"
FT                   /number=5
FT   intron          2334..2774
FT   exon            2775..2807
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39011 null"
FT                   /product="MHC class I antigen"
FT                   /number=6
FT   intron          2808..2913
FT   exon            2914..2961
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39011 null"
FT                   /product="MHC class I antigen"
FT                   /number=8
FT   intron          2962..3059
FT   exon            3060..3064
FT                   /number=8
FT                   /note="part of exon7 and exon8"
FT   intron          3065..>3153
XX
SQ   Sequence 3153 BP; 590 A; 920 C; 996 G; 647 T; 0 other;
     gatcaggacg aagtcccagg tcccggacgg ggctctcagg gtctcaggct ccgagggccg        60
     cgtctgcaat ggggaggcgc agcgttgggg attccccact cccctgagtt tcacttcttc       120
     tcccaacttg tggggtcctt cttccaggat actcgtgacg catccccact tcccactccc       180
     attgggtgtc ggatatctag agaagccaat cagcgtcgcc ggggtcccag ttctaaagtc       240
     cccacgcacc cacccggact cagagtctcc tcagacgccg agatgctggt catggcgccc       300
     cgaaccgtcc tcctgctgct ctcggcggcc ctggccctga ccgagacctg ggccggtgag       360
     tgcgggtcgg gagggaaatg gcctctgccg ggaggagcga ggggaccgca ggcgggggcg       420
     caggacctga ggagccgcgc cgggaggagg gtcgggcggg tctcagcccc tcctcgcccc       480
     caggctccca ctccatgagg tatttctaca cctccgtgtc ccggcccggc cgcggggagc       540
     cccgcttcat ctcagtgggc tacgtggacg acacgcagtt cgtgaggttc gacagcgacg       600
     ccgcgagtcc gagagaggag ccgcgggcgc cgtggataga gcaggagggg ccggaatatt       660
     gggaccggaa cacacagatc tgcaagacca acacacagac tgaccgagag agcctgcgga       720
     acctgcgcgg ctactacaac cagagcgagg ccggtgagtg accccggccc ggggcgcagg       780
     tcacgactcc ccatccccca cgtacggccc gggtcgcccc gagtctccgg gtccgagatc       840
     cgcctccctg aggccgcggg acccgcccag accctcgacc ggcgagagcc ccaggcgcgt       900
     ttacccggtt tcattttcag ttgaggccaa aatccccgcg ggttggtcgg ggcggggcgg       960
     ggctcggggg gacggggctg accgcggggc cggggccagg gtctcacacc ctccagagga      1020
     tgtacggctg cgacgtgggg ccggacgggc gcctcctccg cgggcataac cagttcgcct      1080
     acgacggcaa ggattacatc gccctgaacg aggacctgag ctcctggacc gcggcggaca      1140
     ccgcggctca gatcacccag cgcaagtggg aggcggcccg tgtggcggag cagctgagaa      1200
     cctacctgga gggcacgtgc gtggagtggc tccgcagata cctggagaac gggaaggaga      1260
     cgctgcagcg cgcgggtacc aggggcagtg gggagccttc cccatctcct ataggtcgcc      1320
     ggggatggcc tccaacgaga agaagaggaa aatgggatca gcgctagaat gtcgccctcc      1380
     cttgaatgga gaatggcatg agttttcctg agtttcctct gagggccccc tcttctctct      1440
     aggacaatta agggatgacg tctctgagga aatggagggg aagacagtcc ctagaatact      1500
     gatcaggggt cccctttgac ccctgcagca gccttgggaa ccatgacttt tcctctcagg      1560
     ccttgttctc tgcctcacac tcagtgtgtt tggggctctg attccagcac ttctgagtca      1620
     ctttacctcc actcagatca ggagcagaag tctctgttcc ccgctcagag actcgaactt      1680
     tccaatgaat agattatccc aggtgcctgc gtccaggctg gtgtctgggt tctgtgcccc      1740
     ttccccaccc caggtgtcct gtccattctc aggctggtca catgggtggt cctagggtgt      1800
     cccatgagag atgcaaagcg cctgaatttt ctgactcttc ccatcagacc ccccaaagac      1860
     acatgtgacc caccacccca tctctgacca tgaggccacc ctgaggtgct gggccctggg      1920
     cttctaccct gcggagatca cactgacctg gcagcgggat ggcgaggacc aaactcagga      1980
     caccgagctt gtggagacca gaccagcagg agacagaacc ttccagaagt gggcagctgt      2040
     ggtggtgcct tctggagaag agcagagata cacatgccat gtacagcatg aggggctgcc      2100
     gaagcccctc accctgagat ggggtaagga gggggatgag gggtcatatc tcttctcagg      2160
     gaaagcagga gcccttcagc agggtcaggg cccctcatct tcccctcctt tcccagagcc      2220
     atcttcccag tccaccgtcc ccatcgtggg cattgttgct ggcctggctg tcctagcagt      2280
     tgtggtcatc ggagctgtgg tcgctgctgt gatgtgtagg aggaagagtt caggtaggga      2340
     aggggtgagg ggtggggtct gggttttctt gtcccactgg gggtttcaag ccccaggtag      2400
     aagtgttccc tgcatcatta ctgggaagca gcatgcacac aggggctaac gcagcctggg      2460
     accctgtgtg ccagcactta ctcttttgtg cagcacatgt gacaatgaag gacggatgta      2520
     tcaccttgat ggttgtggtg ttggggtcct gattccagca ttcatgagtc aggggaaggt      2580
     ccctgctaag gacagacctt aggagggcag ttggtccagg acccacactt gctttcctcg      2640
     tgtttcctga tcctgccctg ggtctgtagt catacttctg gaaattcctt ttgggtccaa      2700
     gactaggagg ttcctctaag atctcatggc cctgcttcct cccagtcccc tcacaggaca      2760
     ttttcttccc acaggtggaa aaggagggag ctactctcag gctgcgtgta agtggtgggg      2820
     gtgggagtgt ggaggagctc acccacccca taattcctcc tgtcccacgt ctcctgtggg      2880
     ctctgaccag gtcctgtttt tgttctactc cagccagcga cagtgcccag ggctctgatg      2940
     tgtctctcac agcttgaaaa ggtgagattc ttggggtcta gagtgggcgg gggggcgggg      3000
     agggggcaga ggggaaaggc ctgggtaatg gagattcttt gattgggatg tttcgcgtgt      3060
     gtgatgggct gttcagagtg tcatcactta ccatgactaa ccagaatttg ttcatgactg      3120
     ttgttttctg tagcctgaga cagctgtctt gtg                                   3153
//


spacer
spacer