spacer

EBI Dbfetch

ID   AB088094; SV 1; linear; genomic DNA; STD; HUM; 6057 BP.
XX
AC   AB088094;
XX
DT   08-JAN-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-E gene for major histocompatibility complex, class I, E,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-6057
RA   Shiina T.;
RT   ;
RL   Submitted (08-JUL-2002) to the INSDC.
RL   Takashi Shiina, Tokai University School of Medicine, Molecular Life Sciense
RL   2; Bohseidai, Isehara, Kanagawa 259-1193, Japan
RL   (E-mail:tshiina@is.icc.u-tokai.ac.jp, Tel:81-463-93-1121,
RL   Fax:81-463-94-8884)
XX
RN   [2]
RX   DOI; 10.1534/genetics.106.057034.
RX   PUBMED; 16702430.
RA   Shiina T., Ota M., Shimizu S., Katsuyama Y., Hashimoto N., Takasu M.,
RA   Anzai T., Kulski J.K., Kikkawa E., Naruse T., Kimura N., Yanagiya K.,
RA   Watanabe A., Hosomichi K., Kohara S., Iwamoto C., Umehara Y., Meyer A.,
RA   Wanner V., Sano K., Macquin C., Ikeo K., Tokunaga K., Gojobori T.,
RA   Inoko H., Bahram S.;
RT   "Rapid evolution of major histocompatibility complex class I genes in
RT   primates generates new disease alleles in humans via hitchhiking
RT   diversity";
RL   Genetics 173(3):1555-1570(2006).
XX
DR   MD5; cb17439c00b3abff4ceb3c08c56d20f3.
DR   Ensembl-Gn; ENSG00000206493; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229252; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230254; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233904; homo_sapiens.
DR   Ensembl-Tr; ENST00000383597; homo_sapiens.
DR   Ensembl-Tr; ENST00000415289; homo_sapiens.
DR   Ensembl-Tr; ENST00000415649; homo_sapiens.
DR   Ensembl-Tr; ENST00000427936; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6057
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="LKT3"
FT                   /cell_type="B cell"
FT                   /db_xref="taxon:9606"
FT   CDS             join(91..154,285..554,799..1074,1696..1971,2096..2212,
FT                   2963..2995,3100..3140)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-E"
FT                   /product="major histocompatibility complex, class I, E"
FT                   /note="HLA class I molecule"
FT                   /db_xref="GOA:Q6DU50"
FT                   /db_xref="IMGT/HLA:E*01:01:01:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q6DU50"
FT                   /protein_id="BAC54925.1"
FT                   /translation="MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFIS
FT                   VGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRG
FT                   YYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQI
FT                   SEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATL
FT                   RCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCH
FT                   VQHEGLPEPVTLRWKPASQPTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGS
FT                   YSKAEWSDSAQGSESHSL"
FT   exon            91..154
FT                   /number=1
FT   exon            285..554
FT                   /number=2
FT   exon            799..1074
FT                   /number=3
FT   exon            1696..1971
FT                   /number=4
FT   exon            2096..2212
FT                   /number=5
FT   exon            2963..2995
FT                   /number=6
FT   exon            3100..3142
FT                   /number=7
FT   exon            3308..3312
FT                   /number=8
XX
SQ   Sequence 6057 BP; 1361 A; 1600 C; 1596 G; 1500 T; 0 other;
     tctagagaag ccaatcagcg tcgccacgac tcccgactat aaagtcccca tccggactca        60
     agaagttctc aggactcaga ggctgggatc atggtagatg gaaccctcct tttactcctc       120
     tcggaggccc tggcccttac ccagacctgg gcgggtgagt gcggggtcgg gatggaaacg       180
     gcctctaccg ggagtagaga ggggccggcc cggcgggggc gaaggactcg gggagccgcg       240
     ccgggaggag ggtcgggccg atctcagccc ctcctcgccc ccaggctccc actccttgaa       300
     gtatttccac acttccgtgt cccggcccgg ccgcggggag ccccgcttca tctctgtggg       360
     ctacgtggac gacacccagt tcgtgcgctt cgacaacgac gccgcgagtc cgaggatggt       420
     gccgcgggcg ccgtggatgg agcaggaggg gtcagagtat tgggaccggg agacacggag       480
     cgccagggac accgcacaga ttttccgagt gaacctgcgg acgctgcgcg gctactacaa       540
     tcagagcgag gccggtgagt gaccccggcc aggggagcag gtcacgaccc ctccccatcc       600
     cccacggacg gcgcgggtcc cctcgaatct tcgggtccca gattcacccc aaggctgcgg       660
     aacccgccca gaccctagac cggggagagt ctcaggcgcc tttacccggt tctttttcag       720
     tttaggccaa aatgcccaca gggtggtggc gacgggggcg gggcttggtg ggcgggactg       780
     actaaggggc ggggccaggg tctcacaccc tgcagtggat gcatggctgc gagctggggc       840
     ccgacaggcg cttcctccgc gggtatgaac agttcgccta cgacggcaag gattatctca       900
     ccctgaatga ggacctgcgc tcctggaccg cggtggacac ggcggctcag atctccgagc       960
     aaaagtcaaa tgatgcctct gaggcggagc accagagagc ctacctggaa gacacatgcg      1020
     tggagtggct ccacaaatac ctggagaagg ggaaggagac gctgcttcac ctgggtaaga      1080
     gggtccacag ggctactctc ccatctcctt cttgggctag gactgtgccc acagctgaca      1140
     gacctcaaac agtagaagaa acagggatgg aggccagaat accactcctc ccttggatca      1200
     ggagagggag ctgtcacctg aggtacagga gatcctatac cacagagtga ctctcttaaa      1260
     gggccagacc tctctcaggg gcaattaagg aatctagtct cgctggagat tccatccttc      1320
     agatgaactg atgagcagtt ctctttgact cccagtatta ggaatcacgg gggagtttct      1380
     ctcgtgcctg attctcagcc ccacaccaag agtttttgga ggtctgactc cagcttttct      1440
     cagtcactca gcatccacac aggccaggac cagaaatccc ttttcacctt ctaccctggg      1500
     ctagctcatc ccgattctag aactttccaa ggaataagag gctatcccag atccctaagt      1560
     ccaggctggt gtcaaggttt tgtcctcttc tcctactata attgtcctct tccttctcag      1620
     gatggtcaca tgggtgctgc tggagtgtcc catgagagat acaaagtgcc tgaattttct      1680
     gactcttccc ctcagagccc ccaaagacac acgtgactca ccaccccatc tctgaccatg      1740
     aggccaccct gaggtgctgg gccctgggct tctaccctgc ggagatcaca ctgacctggc      1800
     agcaggatgg ggagggccat acccaggaca cggagctcgt ggagaccagg cctgcagggg      1860
     atggaacctt ccagaagtgg gcagctgtgg tggtgccttc tggagaggag cagagataca      1920
     cgtgccatgt gcagcatgag gggctacccg agcccgtcac cctgagatgg agtaaggagg      1980
     gggatgggag gtcatgtctc ttctcaggga aagcgggagc ccttctggag cccttccgca      2040
     gggtcagggc tgaggcctgg gggtcagggc cccttacgtt cccctctttt cccagagccg      2100
     gcttcccagc ccaccatccc catcgtgggc atcattgctg gcctggttct ccttggatct      2160
     gtggtctctg gagctgtggt tgctgctgtg atatggagga agaagagctc aggtggggaa      2220
     gggagaaggg tggggtctga gttttcttgt cccactgggt gtttcaagcc ctaggtaaaa      2280
     gtgtgtcctg cctcgttact gggaagcacc atccacacac acgagcctac ccagcctggg      2340
     gccctgtgtg ccagcaccta ctcttttttt ttgagacgga gtcttggctc tgtcacccag      2400
     gctggagtgc aatggcgtgg tttcagctca ctgcaacctc cgcctcccag gttcaagcaa      2460
     ttctcctgcc tcagcctccc tagtagctgg gactacacat gcgtgccacc acacctggct      2520
     aatttttttt tttgtatttt tagtggagat ggggtttcac tatgttggcc aggctggtct      2580
     cgaactcctg actttgtgat ctgcctgcct cggcctccca aagtgctggg attacagtcg      2640
     tgagccaccg cacccagccg cacctactct tttgtaaagc acctgtgaca atgaaggaca      2700
     gatttatcac cttgacgatt gtggtgatgg ggacctgatc ccagcagtca caggtcacag      2760
     gggaaggtcc ctgctgaaga cagacctcag aagggcagtt gatccaggac ccacacctgc      2820
     tttcttcacg tttcctgatc ctgccctggg tctgcagtca cagttcagga aacttctctg      2880
     ggatccaaaa ctaggaggtt cctctaggac cttatggccc tgcctcctcc ctggcccctc      2940
     acaggacatt ttcttccaac aggtggaaaa ggagggagct actctaaggc tgagtgtaag      3000
     tgcggggcgg gagtgtggag gagctcgccc accctataat tcctcctgca ccacatctcc      3060
     tgtgggctct gaccaggtct tgtttttgtt ctaccccagg gagcgacagt gcccaggggt      3120
     ctgagtctca cagcttgtaa aggtgagatt ctgggggtct gaagtgggtg gagggtgggg      3180
     cagaggggac aggactgggt tgtggggatt ttttgattca gaatttttga gtgtgtggtg      3240
     ggctgttcag agtgtcatca cttaccgtga ctgacctgaa tttgttcatg actattttct      3300
     tctgtagcct gagacagctg ccttgtgtgc gactgagatg cacagctgcc ttgtgtgcga      3360
     ctgagatgca ggatttcctc acgcctcccc tatgtgtctt aggggactct ggcttctctt      3420
     tttgcaaggg cctctgaatc tgtctgtgtc cctgttagca caatgtgagg aggtagagaa      3480
     acagtccacc tctgtgtcta ccatgacccc cttcctcaca ctgacctgtg ttccttccct      3540
     gttctctttt ctattaaaaa taagaacctg ggcagagtgc ggcagctcat gcctgtaatc      3600
     ccagcactta gggaggccga ggagggcaga tcacgaggtc aggagatcga aaccatcctg      3660
     gctaacacgg tgaaaccccg tctctactaa aaaatacaaa aaattagctg ggcgcagagg      3720
     cacgggcctg tagtcccagc tactcaggag gcggaggcag gagaatggcg tcaacccggg      3780
     aggcggaggt tgcagtgagc caggattgtg cgactgcact ccagcctggg tgacagggtg      3840
     aaacgccatc tcaaaaaata aaaattaaaa aataaaaaaa gaacctggat ctcaatttaa      3900
     tttttcatat tcttgcaatg aaatggactt gaggaagcta agatcatagc tagaaataca      3960
     gataattcca cagcacatct ctagcaaatt tagcctattc ctattctcta gcctattcct      4020
     taccacctgt aatcttgacc atataccttg gagttgaata ttgttttcat actgctgtgg      4080
     tttgaatgtt ccctccaaca ctcatgttga gacttaatcc ctaatgtggc aatactgaaa      4140
     ggtggggcct ttgagatgtg attggatcgt aaggctgtgc cttcattcat gggttaatgg      4200
     attaatgggt tatcacagga atgggactgg tggctttata agaagaggaa aagagaactg      4260
     agctagcatg cccagcccac agagagcctc cactagagtg atgctaagtg gaaatgtgag      4320
     gtgcagctgc cacagagggc ccccaccagg gaaatgtcta gtgtctagtg gatccaggcc      4380
     acaggagaga gtgccttgtg gagcgctggg agcaggacct gaccaccacc aggaccccag      4440
     aactgtggag tcagtggcag catgcagcgc ccccttggga aagctttagg caccagcctg      4500
     caacccattc gagcagccac gtaggctgca cccagcaaag ccacaggcac ggggctacct      4560
     gaggccttgg gggcccaatc cctgctccag tgtgtccgtg aggcagcaca cgaagtcaaa      4620
     agagattatt ctcttcccac agataccttt tctctcccat gaccctttaa cagcatctgc      4680
     ttcattcccc tcaccttccc aggctgatct gaggtaaact ttgaagtaaa ataaaagctg      4740
     tgtttgagca tcatttgtat ttcatttgtg cgttttgtgc cttgttgttt taatttttta      4800
     accacattca agctatcctt tggcttccaa tgccatggtc cacccagaac tgcattcact      4860
     ggcccgtgtt ctagttctgg tcatgccgac tttcccgttt tcctggtgaa tccctgtaat      4920
     cacctgagtc tcattctgtc aggtgatatc cagtaagaag gcaacatgtg cggtgagaaa      4980
     gcccagggag tcctgggtgt gaatttttac tttgccattt cttcctgtgt gacacgcggt      5040
     ggggcttcac ctgtctgagc tccagttcct catcttgtac gtggcactgt tttcttggga      5100
     gagtcattat aaagctaata taaagtacct gtactgtggt ttgaatgtgt cctccaaaaa      5160
     gcgtgtgttg gaaactgaat ccacaatgca accatatcgg gaagtgaatc ctaatggctg      5220
     gctggccatg gaggttccaa ctttatgaat ggattaatac tgattataaa agggcttgag      5280
     gttgaggcaa gttcaacctc ttgccctcac tcacccactt gcctttacca agagatgata      5340
     cagcaaaaag actcaccaaa tgccgggatc ttgatattag acttcttatc ctccagaacc      5400
     atgaaatagg ctgctttgct ttataaatta ctcagtctgc gtattatatt acagcaacac      5460
     aagatgggca acctgatact taggtttcag ttagtggtag atatttttat ttcaagcatt      5520
     cctactggag tattagtttc ttcataagcc cagaatcttt gcattttagc aacaacaaat      5580
     aagtcttttt tttttttttt ttttttgaga ctgagtttca ctcttgtcac ccaggctaga      5640
     gtgcaatggc atgaccttgg ctcactgcaa acttggcctc ccaggtttaa gtgattctcc      5700
     tgcttcagcc tcccaagtag ctgggattac aggcgcctgc taccacgccc agctaatttt      5760
     tgtattttta gtagagacag agtttcatca tgttggccag ctggtctcga actcctgatc      5820
     tcaggtgatc cacccacctt ggcctcccaa agtgctggga ttataggcat gagccaccac      5880
     gttccaccag aagtcttaat taatgcaaag aaaatcaatc tatagatttg atggaaattt      5940
     ggactcctat atcctacttt ttatcccact cctatatact actccttatt agtgtcccag      6000
     aaagatgaac tattttcctt ctctacttgg tctgcccatt tctacttcct gccatat         6057
//


spacer
spacer