spacer

EBI Dbfetch

ID   AB088083; SV 1; linear; genomic DNA; STD; HUM; 5517 BP.
XX
AC   AB088083;
XX
DT   08-JAN-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-G gene for HLA-G histocompatibility antigen, class I, G,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-5517
RA   Shiina T.;
RT   ;
RL   Submitted (08-JUL-2002) to the INSDC.
RL   Takashi Shiina, Tokai University School of Medicine, Molecular Life Sciense
RL   2; Bohseidai, Isehara, Kanagawa 259-1193, Japan
RL   (E-mail:tshiina@is.icc.u-tokai.ac.jp, Tel:81-463-93-1121,
RL   Fax:81-463-94-8884)
XX
RN   [2]
RX   DOI; 10.1534/genetics.106.057034.
RX   PUBMED; 16702430.
RA   Shiina T., Ota M., Shimizu S., Katsuyama Y., Hashimoto N., Takasu M.,
RA   Anzai T., Kulski J.K., Kikkawa E., Naruse T., Kimura N., Yanagiya K.,
RA   Watanabe A., Hosomichi K., Kohara S., Iwamoto C., Umehara Y., Meyer A.,
RA   Wanner V., Sano K., Macquin C., Ikeo K., Tokunaga K., Gojobori T.,
RA   Inoko H., Bahram S.;
RT   "Rapid evolution of major histocompatibility complex class I genes in
RT   primates generates new disease alleles in humans via hitchhiking
RT   diversity";
RL   Genetics 173(3):1555-1570(2006).
XX
DR   MD5; c23c9d5a54d0b07917c2f9375c8b499a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5517
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="LKT3"
FT                   /cell_type="B cell"
FT                   /db_xref="taxon:9606"
FT   CDS             join(1141..1213,1343..1612,1839..2114,2714..2989,
FT                   3112..3228,3674..3678)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HLA-G"
FT                   /product="HLA-G histocompatibility antigen, class I, G"
FT                   /note="HLA class I molecule"
FT                   /db_xref="GOA:Q8MGQ7"
FT                   /db_xref="IMGT/HLA:G*01:04:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MGQ7"
FT                   /protein_id="BAC54916.1"
FT                   /translation="MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPR
FT                   FIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQT
FT                   LRGYYNQSEASSHTLQWMIGCDLGSDGRLIRGYEQYAYDGKDYLALNEDLRSWTAADTA
FT                   AQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYE
FT                   ATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD"
FT   exon            1141..1213
FT                   /number=1
FT   exon            1343..1612
FT                   /number=2
FT   exon            1839..2114
FT                   /number=3
FT   exon            2714..2989
FT                   /number=4
FT   exon            3112..3228
FT                   /number=5
FT   exon            3674..3678
FT                   /number=6
XX
SQ   Sequence 5517 BP; 1214 A; 1434 C; 1523 G; 1346 T; 0 other;
     ttacatccat ctacagagcc tcgctgggtg ttctttgcag ttggccttta atatcttatg        60
     tgggtctgcc tagaaactaa ttgtttttta tgttaatcag gtttaaaaaa tactaagtat       120
     tcctaaaaaa tatacactcc actcacatgt ggatacttcc taaaaacagg cagtgcatga       180
     gcactagtga ggggcattgt gactgcactg aacacttaca actgtgaggt gaataaagtt       240
     tgtgctggct cctggttgca acatatagta acatagtgtg gtactttgtc ttgaggagat       300
     gtcctggact cacacggaaa cttagggcta cggaatgaag gtaaatttaa aataaaacaa       360
     gcgggagtca cagatacatt gtctgggaaa gtgaaactta agagctttgt gagtcctgtt       420
     gtaaggcttt tagatgcatt tatataccaa cgggccaaag tcacattttt tacctattag       480
     attcctgatc attcaggggt taccaagatt atgctaccca ctatagttaa taaacaaaaa       540
     gcaaactggt ctctattcta tctcatgcac tcaggcacaa cttttccaga tttaaggggg       600
     aaaaaaaacc ctgtctttac acctacaatc ccagggcgag ctcactctct ggcaccaagc       660
     tccgtggggt gatttttctt ctagaagagt acaggagaac aggcaaggag tgggaggcag       720
     ggagtccagt tcagggacag ggattccggg atgaaaagtg aagggagagg gacagggacc       780
     ttgccgaggg tttctccctg gtttctcaga cagctcctgg gccaagactc agggagacac       840
     tgagacagaa cgcttggcac aagagtagcg gggtcagggc gaagtcccag ggcctcaagc       900
     gtggctctca gggtctcagg ccccacaggc ggtgtatgga ttggggaggc cccgcgttgg       960
     ggattctctc ctccttctcc taacctgtgt cgggtccttc ttcctggata ctcaccgggc      1020
     ggccccagtt ctcactccca ttaggtgaca ggtttttaga gaagccaatc agcgtcgccg      1080
     cggtcctggt tctaaagtcc tcgctcaccc acccggactc attctcccca gacgccaagg      1140
     atggtggtca tggcaccccg aaccctcttc ctgctactct cgggggccct gaccctgacc      1200
     gagacctggg cgggtgagtg cggggtcagg agggaaacgg cccctgcgcg gaggagggag      1260
     gggccggccc ggcgggggcg caggacccgg cagccgcgcc gggaggaggg tcgggcgggt      1320
     ctcaacctct cctcgccccc aggctcccac tccatgaggt atttcagcgc cgccgtgtcc      1380
     cggcccggcc gcggggagcc ccgcttcatc gccatgggct acgtggacga cacgcagttc      1440
     gtgcggttcg acagcgactc ggcgtgtccg aggatggagc cgcgggcgcc gtgggtggag      1500
     caggaggggc cagagtattg ggaagaggag acacggaaca ccaaggccca cgcacagact      1560
     gacagaatga acctgcagac cctgcgcggc tactacaacc agagcgaggc cagtgagtaa      1620
     ccccggccca gggcgcagat cacgaccccc cacctccatg ccccacggac gccccgggta      1680
     ctcccgagtc tccgggtctg ggatccaccc cgaggccgcg ggacccgccc agaccctcta      1740
     cctgggagaa ccccaggcgc ctttaccaaa atccctgcgg gtgggtccgg gcgagggcga      1800
     ggctcggtgg gcggggctga ccgaaggggt ggggccaggt tctcacaccc tccagtggat      1860
     gattggctgc gacctggggt ccgacggacg cctcatccgc gggtatgaac agtatgccta      1920
     cgatggcaag gattacctcg ccctgaacga ggacctgcgc tcctggaccg cagcggacac      1980
     tgcggctcag atctccaagc gcaagtgtga ggcggccaat gtggctgaac aaaggagagc      2040
     ctacctggag ggcacgtgcg tggagtggct ccacagatac ctggagaacg ggaaggagat      2100
     gctgcagcgc gcgggtacca ggggcagtgg ggcgcctccc tgatctcctg tagacctccc      2160
     agcctggcct agcacaagga gaggaggaaa atgggaccaa caccagaata tcgccctccc      2220
     tctggtcctg agggagagga atcctcctgg gtttccagat cctgtaccag agagtgattc      2280
     tgagggcccg tcctgctctc tgggacaatt aagggatgaa gtctctgagg gagtggaggg      2340
     gaagacaatc cctggaggac tgatcagggg ttccctttga ccccacagca gccttggcac      2400
     caggactttt cccctcaggc cttgttctct gcctcacact caatgtgtgt gggagtctga      2460
     ctccagctcc tctgagtccc ttggcctcca ctcaggtcag aaccagaggt ccctgctccc      2520
     ccgctcagag actagaactt tccaaggaat aggagattat cccaggtgcc cgtgtccagg      2580
     ctggtgtctg ggttctgtgc tcccttcccc accccaggta tctggttcat tcttaggatg      2640
     gtcacatcca ggtgctgctg gagtgtccca tgagagatgc aaagtgcttg agttttctga      2700
     ctcttccttt cagacccccc caagacacac gtgacccacc accctgtctt tgactatgag      2760
     gccaccctga ggtgctgggc cctgggcttc taccctgcgg agatcatact gacctggcag      2820
     cgggatgggg aggaccagac ccaggacgtg gagctcgtgg agaccaggcc tgcaggggat      2880
     ggaaccttcc agaagtgggc agctgtggtg gtgccttctg gagaggagca gagatacacg      2940
     tgccatgtgc agcatgaggg gctgccggag cccctcatgc tgagatggag taaggaggga      3000
     gatggaggca tcatgtctgt tagggaaagc aggagcctct ctgaagacct ttaacagggt      3060
     cggtggtgag gcctgggggt cagagaccct caccttcacc tcctttccca gagcagtctt      3120
     ccctgcccac catccccatc atgggtatcg ttgctggcct ggttgtcctt gcagctgtag      3180
     tcactggagc tgcggtcgct gctgtgctgt ggaggaagaa gagctcaggt aaggaagggg      3240
     tgacaagtgg ggtctgagtt ttcttgtccc actgggggtt tcaagcccca ggtagaagtg      3300
     cgccctgcct ggttactggg aagcaccatc cacactcatg ggcctaccca gcctgggccc      3360
     tgtgtgccag caccttctct tttgtaaagc acctgtgaca atgaaggaca gatttatcac      3420
     cttgatgatt gtagtgatgg ggacctgatc ctagtaatca caggtcaggg gaaggtccct      3480
     ggctaaggac agaccttagg agggcagttg gtcgaggacc cacatctgct ttccttgttt      3540
     ttcctgatcc cgccctgagt ctgcagtcac acatttctgg aaacttctcg agggtccaag      3600
     actaggaggt tcctctagga cctcatggcc ctgccacctt tctggcctct cacaggacgt      3660
     tttcttccca cagattgaaa aggagggagc tactctcagg ctgcaagtaa gtatgaagga      3720
     ggctgatccc tgagatcctt gggatcttgt gtttgggagc ccatggggga gctcacccac      3780
     cccacaattc ctcctctggc cacatctcct gtggtctctg accaggtgct gtttttgttc      3840
     tactctaggc agtgacagtg cccagggctc taatgtgtct ctcacggctt gtaaatgtga      3900
     caccccgggg ggcctgatgt gtgtgggttg ttgaggggaa cagtggacat agctgtgcta      3960
     tgaggtttct ttgacttgaa tgtattgagc atgtgatggg ctgtttaaag tgtcacccct      4020
     cactgtgact gatatgaatt tgttcatgaa tatttttctg tagtgtgaaa cagctgccct      4080
     gtgtgggact gagtggcaag tccctttgtg acttcaagaa ccctgacttc tctttctgca      4140
     gagaccagcc cacccctgtg cccaccatga ccctcttcct catgctgaac tgcattcctt      4200
     ccccaatcac ctttcctgtt ccagaaaagg ggctgggatg tctccgtctc tgtctcaaat      4260
     ttgtggtgca ctgagctata acttacttct gtattaaaat tagaatctga gtataaattt      4320
     actttttcaa attatttcca agagagattg atgggttaat taaaggagaa gattcctgaa      4380
     atttgagaga caaaataaat ggaagacatg agaactttcc acagtacacg tgtttcttgt      4440
     gctgatttgt tgcaggagag gagagtagat ggggctgcgc ccagtgggtg ctcaggccac      4500
     catgaacttt atgtggtcac tgctcagctg ggtcatcttt gctgctctat tgtccttggc      4560
     ccttcagtag aaccttgtcc caccaggacc tgtgatcaca tagacttgga tatcacctag      4620
     ggtggtccct acacgtagaa gttcctgtgt tatcagaaga aaaattttca gacccctaca      4680
     cctcttcccc tccttccagg tctctttcaa ttgtattttc catctttttt tttttttttt      4740
     ttttttttga gatggagtct cactcaggct ggagtgcagt ggtgcaatct cgactcattg      4800
     caacctccac ctcccgggtt caagcaattc tcctgtctca gcctccctag taactgggag      4860
     tacaggcaca tgccacgata cccagctaat tttttgtatt tttagtaaag acgggatttc      4920
     accatgttag ccaggatggt cttgatctcc tgaccttgtg atttgcccgc ctctgcctcc      4980
     caaagtgctg ggattacagg tgtgagccac catgcctggc ttccccaacc ttcttaaagg      5040
     aagcagattc tgaaacttcc cgagaggaga ggtcccagag tttttcattg tagtttactt      5100
     tctgttggaa ctcctcttct gctctctctc ctactcttct tcctgccctg agttgtagta      5160
     atcctattgc tggctccaaa ccaaactcat ggatttgtaa agcagagtct aatttagatt      5220
     catatgtggt tggataattg gagccataag ccttgggtta tctttcctga agagacaaat      5280
     atggttgtgt gctgcagtgt gcaggaggat tggtgtggga ggagggaggg agggaggaca      5340
     caaaagcagc cctggtgaga aaagcactgg tgcatttata tccacatgag ataatattgt      5400
     tccacagcgg ctacaaaatg acatttggcc tgagtctaca ttaataaaga tattgccttt      5460
     agaatagggg ggcgcactac agtaatcatc cattcaagtg gcatttgttg tctgcta         5517
//


spacer
spacer