spacer

EBI Dbfetch

ID   AB087518; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AB087518; AB087517;
XX
DT   05-JUL-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Shimizu M., Kashiwase K., Satake M.;
RT   ;
RL   Submitted (03-JUL-2002) to the INSDC.
RL   Marie Shimizu, Tokyo Red Cross Blood Center, Research; Hiroo 4-1-31,
RL   Shibuya-ku, Tokyo 150-0012, Japan (E-mail:ma-shimizu@tokyo.bc.jrc.or.jp,
RL   Tel:81-3-3406-1211, Fax:81-3-3406-7892)
XX
RN   [2]
RA   Shimizu M., Kashiwase K., Satake M.;
RT   "HLA-B*5201V2(weak reacted to antisera of B5)";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A*2402101,B*4002/5201V2,Cw10,DRB1*1501/1502,
FT                   TBC-B31953"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5201V2"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q8MHP3"
FT                   /db_xref="IMGT/HLA:B*52:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MHP3"
FT                   /protein_id="BAC02741.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPPFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5201V2"
FT                   /product="MHC class I antigen"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5201V2"
FT                   /product="MHC class I antigen"
FT                   /number=3
XX
SQ   Sequence 646 BP; 114 A; 174 C; 187 G; 71 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     ccttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac ttggcagacg atgtatggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcataa ccagtacgcc tacgacggca aagattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg       600
     ctccgcagac acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer