spacer

EBI Dbfetch

ID   AB087514; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AB087514; AB087513;
XX
DT   05-JUL-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Shimizu M., Kashiwase K., Satake M.;
RT   ;
RL   Submitted (03-JUL-2002) to the INSDC.
RL   Marie Shimizu, Tokyo Red Cross Blood Center, Research; Hiroo 4-1-31,
RL   Shibuya-ku, Tokyo 150-0012, Japan (E-mail:ma-shimizu@tokyo.bc.jrc.or.jp,
RL   Tel:81-3-3406-1211, Fax:81-3-3406-7892)
XX
RN   [2]
RA   Shimizu M., Kashiwase K., Satake M.;
RT   "HLA-B55V2(B56 cross reacting antigen),recombination between HLA-B*5502 and
RT   B*3501";
RL   Unpublished.
XX
DR   MD5; 283291308633ab7511ff8b078ff6141a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A*02011/0206,B*5502/55V2,Cw1/9,DRB1*1501/0406,
FT                   TBC-T4899"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55V2"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q8MHP5"
FT                   /db_xref="IMGT/HLA:B*56:09"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MHP5"
FT                   /protein_id="BAC02739.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55V2"
FT                   /product="MHC class I antigen"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*55V2"
FT                   /product="MHC class I antigen"
FT                   /number=3
XX
SQ   Sequence 646 BP; 110 A; 171 C; 194 G; 71 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacat catccagagg atgtatggct gcgacctggg gcccgacggg       420
     cgcctcctcc gcgggcatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer