spacer

EBI Dbfetch

ID   AB073668; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AB073668; AB073300;
XX
DT   02-NOV-2001 (Rel. 69, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-B gene for MHC class I antigen, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Araseki M., Takahashi D., Sekimoto T., Miyazaki T., Sato S., Kato T.,
RA   Ikeda H.;
RT   ;
RL   Submitted (29-OCT-2001) to the INSDC.
RL   Miki Araseki, Hokkaido Red Cross Blood Center, Laboratory section; 2-2,
RL   Yamanote, Nishi-ku, Sapporo, Hokkaido 063-0002, Japan
RL   (E-mail:araseki@hokkaido.bc.jrc.or.jp,
RL   URL:http:www//hokkaido.bc.jrc.or.jp/, Tel:81-11-613-6635,
RL   Fax:81-11-613-6228)
XX
RN   [2]
RA   Araseki M., Takahashi D., Sekimoto T., Miyazaki T., Sato S., Kato T.,
RA   Ikeda H.;
RT   "Identification of a new HLA-B7 allele in Japanese";
RL   Unpublished.
XX
RN   [3]
RX   DOI; 10.1111/j.1399-0039.1997.tb02839.x.
RX   PUBMED; 9243761.
RA   Cereb N., Yang S.Y.;
RT   "Dimorphic primers derived from intron 1 for use in the molecular typing of
RT   HLA-B alleles";
RL   Tissue Antigens 50(1):74-76(1997).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-type:A24/26, B*07v/1501101, Cw7/9"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="allele:HLA-B*07v"
FT                   /db_xref="GOA:Q95HD7"
FT                   /db_xref="IMGT/HLA:B*07:30"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95HD7"
FT                   /protein_id="BAB71761.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PPAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            <1..270
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /number=2
FT                   /note="allele:HLA-B*07v"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..>646
FT                   /number=3
XX
SQ   Sequence 646 BP; 111 A; 173 C; 193 G; 69 T; 100 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg ccggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagc atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcatga ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagcggaga gcctacctgg agggcgagtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggac aagctggagc gcgctg                      646
//


spacer
spacer