spacer

EBI Dbfetch

ID   AB073217; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AB073217; AB073216;
XX
DT   02-NOV-2001 (Rel. 69, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens HLA-A gene for MHC class I antigen, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Araseki M., Takahashi D., Sekimoto T., Miyazaki T., Sato S., Kato T.,
RA   Ikeda H.;
RT   ;
RL   Submitted (17-OCT-2001) to the INSDC.
RL   Miki Araseki, Hokkaido Red Cross Blood Center, Laboratory section; 2-2,
RL   Yamanote, Nishi-ku, Sapporo, Hokkaido 063-0002, Japan
RL   (E-mail:araseki@hokkaido.bc.jrc.or.jp,
RL   URL:http:www//hokkaido.bc.jrc.or.jp/, Tel:81-11-613-6635,
RL   Fax:81-11-613-6228)
XX
RN   [2]
RA   Araseki M., Takahashi D., Sekimoto T., Miyazaki T., Sato S., Kato T.,
RA   Ikeda H.;
RT   "Identification of a new HLA-A11 allele in Japanese";
RL   Unpublished.
XX
RN   [3]
RX   DOI; 10.1034/j.1399-0039.1999.530109.x.
RX   PUBMED; 10082434.
RA   Kurz B., Steiert I., Heuchert G., Muller C.A.;
RT   "New high resolution typing strategy for HLA-A locus alleles based on dye
RT   terminator sequencing of haplotypic group-specific PCR-amplicons of exon 2
RT   and exon 3";
RL   Tissue Antigens 53(1):81-96(1999).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-type:A*11v/0207, B46/67, Cw1/7, DRB1*15/08"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /note="allele:HLA-A*11v"
FT                   /db_xref="GOA:Q95HD8"
FT                   /db_xref="IMGT/HLA:A*11:13"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95HD8"
FT                   /protein_id="BAB71760.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQIMYGCDVGP
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITRRKWEAAHAAEQQRAYLEGRC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            <1..270
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /number=2
FT                   /note="allele:HLA-A*11v"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..>646
FT                   /number=3
XX
SQ   Sequence 646 BP; 109 A; 164 C; 199 G; 74 T; 100 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagata atgtatggct gcgacgtggg gccggacggg       420
     cgcttcctcc gcgggtaccg gcaggacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcttggac cgcggcggac atggcagctc agatcaccag gcgcaagtgg       540
     gaggcggccc atgcggcgga gcagcagaga gcctacctgg agggccggtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgg                      646
//


spacer
spacer