spacer

EBI Dbfetch

ID   AB051357; SV 1; linear; genomic DNA; STD; HUM; 546 BP.
XX
AC   AB051357;
XX
DT   22-NOV-2000 (Rel. 65, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens gene for HLA-B52 variant, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Sekimoto T., Araseki M., Sato S., Kato T., Ikeda H.;
RT   ;
RL   Submitted (17-NOV-2000) to the INSDC.
RL   Tatsuya Sekimoto, Hokkaido Red Cross Blood Center, Laboratory section; 2-2,
RL   Yamanote, Sapporo, nisi-ku, Hokkaido 063-0002, Japan
RL   (E-mail:sekimoto@hokkaido.bc.jrc.or.jp,
RL   URL:http:www//hokkaido.bc.jrc.or.jp/, Tel:81116136635, Fax:81116136228)
XX
RN   [2]
RX   DOI; 10.1034/j.1399-0039.2001.580511.x.
RX   PUBMED; 11844148.
RA   Sekimoto T., Araseki M., Sato S., Sakaya S., Kato T., Ikeda H.;
RT   "Identification of a novel allele HLA-B*7805 in a Japanese female";
RL   Tissue Antigens 58(5):345-348(2001).
XX
DR   MD5; 681a54005ec528f7b4583beabfbdfed2.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>545
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-B52v"
FT                   /product="HLA-B52 variant"
FT                   /db_xref="GOA:Q9GJ55"
FT                   /db_xref="IMGT/HLA:B*78:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9GJ55"
FT                   /protein_id="BAB18306.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRA"
XX
SQ   Sequence 546 BP; 114 A; 172 C; 190 G; 70 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac ttggcagacg atgtatggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagtacgcc tacgacggca       360
     aagattacat cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga gcagctgaga gcctacctgg       480
     agggcctgtg cgtggagtgg ctccgcagac acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//


spacer
spacer