spacer

EBI Dbfetch

ID   AB046526; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AB046526;
XX
DT   27-JUL-2000 (Rel. 64, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-DRB1-0809  gene for MHC class II antigen protein, partial
DE   cds, exon 2.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Juji T., Kashiwase K., Ishikawa Y.;
RT   ;
RL   Submitted (24-JUL-2000) to the INSDC.
RL   Takeo Juji, Japanese Red Cross Central Blood Center, Research; Hiroo
RL   4-1-31, Shibuya-ku, Tokyo 150-0012, Japan (E-mail:kasiwase@cbc.jrc.or.jp,
RL   Tel:81-3406-1211, Fax:81-3406-7892)
XX
RN   [2]
RA   Juji T., Kashiwase K., Ishikawa Y.;
RT   "HLA-DRB1-0809 complete for exon2";
RL   Unpublished.
XX
DR   MD5; 7a79f46f0db8f31e725014a34f02153e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen protein"
FT                   /note="allele:HLA-DRB1-0809"
FT                   /db_xref="GOA:Q9MY29"
FT                   /db_xref="IMGT/HLA:DRB1*08:09"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9MY29"
FT                   /protein_id="BAB03347.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDFLEDRRALVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /number=2
XX
SQ   Sequence 270 BP; 55 A; 63 C; 99 G; 53 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacggtg cagcggcgag                                        270
//


spacer
spacer