spacer

EBI Dbfetch

ID   AB036049; SV 1; linear; genomic DNA; STD; HUM; 546 BP.
XX
AC   AB036049;
XX
DT   23-DEC-1999 (Rel. 62, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-B1501V2 gene for MHC class I antigen, partial cds.
XX
KW   HLA-B1501V2; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Juji T., Akesaka T., Kashiwase K., Ishikawa Y.;
RT   ;
RL   Submitted (17-DEC-1999) to the INSDC.
RL   Takeo Juji, Japanese Red Cross Central Blood Center, Research; 4-1-31,
RL   Shibuya 150-0012, Japan (E-mail:kasiwase@hla.cbc.jrc.or.jp,
RL   Tel:+81-3406-1211, Fax:+81-3406-7892)
XX
RN   [2]
RP   1-546
RA   Juji T., Akesaka T., Kashiwase K., Ishikawa Y.;
RT   "HLA-B1501V2";
RL   Unpublished.
XX
DR   MD5; 589e4b6733e3f2cd26238a50ad632087.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA type:HLA-A2/A11.1,B62(B*1501)/B1501V2,Cw7/Cw9"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-B1501V2"
FT                   /product="MHC class I antigen"
FT                   /note="allele:HLA-B1501V2"
FT                   /db_xref="GOA:Q9TP20"
FT                   /db_xref="IMGT/HLA:B*15:46"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TP20"
FT                   /protein_id="BAA88570.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /number=2
FT   exon            271..546
FT                   /number=3
XX
SQ   Sequence 546 BP; 113 A; 171 C; 193 G; 69 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac cctccagagg atgtacggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcatga ccagtccgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac acggcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga gcagtggaga gcctacctgg       480
     agggcctgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//


spacer
spacer