spacer

EBI Dbfetch

ID   AB033712; SV 1; linear; genomic DNA; STD; ROD; 1152 BP.
XX
AC   AB033712;
XX
DT   31-OCT-1999 (Rel. 61, Created)
DT   21-DEC-2000 (Rel. 66, Last updated, Version 3)
XX
DE   Tokudaia osimensis irbp gene for interphotoreceptor retinoid binding
DE   protein, partial cds.
XX
KW   interphotoreceptor retinoid binding protein.
XX
OS   Tokudaia osimensis (Amami-oshima island spiny rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Tokudaia.
XX
RN   [1]
RP   1-1152
RA   Suzuki H., Serizawa K.;
RT   ;
RL   Submitted (19-OCT-1999) to the INSDC.
RL   Hitoshi Suzuki, Hokkaido University, Graduate School of Environmental Earth
RL   Sciences; North 10, West 5, Kita-ku, Sapporo 060-0810, Japan
RL   (E-mail:htsuzuki@ees.hokudai.ac.jp, Tel:81-11-706-2225(ex.2225),
RL   Fax:81-11-706-2225)
XX
RN   [2]
RX   DOI; 10.1023/A:1001828203201.
RX   PUBMED; 10862357.
RA   Serizawa K., Suzuki H., Tsuchiya K.;
RT   "A phylogenetic view on species radiation in Apodemus inferred from
RT   variation of nuclear and mitochondrial genes";
RL   Biochem. Genet. 38(1-2):27-40(2000).
XX
RN   [3]
RX   DOI; 10.1006/mpev.1999.0732.
RX   PUBMED; 10764531.
RA   Suzuki H., Tsuchiya K., Takezaki N.;
RT   "A molecular phylogenetic framework for the Ryukyu endemic rodents Tokudaia
RT   osimensis and Diplothrix legata";
RL   Mol. Phylogenet. Evol. 15(1):15-24(2000).
XX
DR   MD5; f58dc1b3bc59ad37dffa3b539ab4bb8e.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1152
FT                   /organism="Tokudaia osimensis"
FT                   /isolate="HS1162"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:73109"
FT   CDS             <1..>1152
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:Q9R0H7"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q9R0H7"
FT                   /protein_id="BAA85873.1"
FT                   /translation="AHVLTTGVQSSLNDPRLFISYEPSTLEAPQQAPALTNLTREELLA
FT                   QIQKNIHHEVLEGNVGYLRVDDLPGQEVLSELGEFLVSHVWKQLIGTSSLVLDLRHCTG
FT                   GHVSGIPYVISYLHPGNTVMHVDTIYDRPSNTTTEIWTLPKVLGERYSADKDVVVLTSG
FT                   HTGGVAEDIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSNFFLTVPVSRSLGPLGGG
FT                   GQTWEGSGVLPCVGIPAEQALEKALAILALRRALPGVVLRLQEALQDYYTLVDRVPGLL
FT                   HHLASMDYSAVVSEEDLVTKLNAGLQAVSEDPRLLVRATGAREASSRPETGPNDPPTTT
FT                   PEVPKEEDARRALVDSVFQVSVLPGNVGYLRFDRFADASVLRTL"
XX
SQ   Sequence 1152 BP; 245 A; 339 C; 337 G; 231 T; 0 other;
     gcccatgtgc tgacgactgg agtacagagt tccttgaatg acccacgtct cttcatctct        60
     tatgagccca gtaccctcga ggctccccag caagccccag cgctcaccaa cctcacccga       120
     gaagaactgc tggcccagat acagaagaac atccaccacg aggtgcttga gggcaacgtg       180
     ggctacctac gagtagatga cctccctggc caggaggtac tgagtgagct gggggagttc       240
     ttagtgagtc atgtgtggaa gcagctcata ggcacctcct ccttggtgct agatctccgg       300
     cactgcactg gtggccacgt ctctgggatc ccttatgtca tctcttactt gcaccctggg       360
     aacactgtca tgcacgtgga caccatctat gaccgtccct ccaacaccac cacagagatc       420
     tggaccttgc ccaaggtcct aggggagaga tacagtgctg acaaggacgt ggtggtcctc       480
     accagtggac acacaggggg agttgctgag gacatcgcct acatcctcaa gcagatgcgc       540
     agggccatcg tggtgggtga gcggacagaa ggtggtgccc tggacctcca gaagctgaga       600
     ataggccagt ccaacttctt cctcacagtg cctgtgtcca ggtccctggg acccctaggt       660
     ggaggtggcc agacatggga aggcagtgga gtgctgccct gtgtggggat acctgcagag       720
     caagccctag aaaaggccct ggccatcctc gctctgcgtc gggccctgcc aggggttgtc       780
     ctccgacttc aggaagccct ccaggactat tatacattag tggaccgagt gccaggcctg       840
     ctgcaccacc tggctagcat ggactactca gctgtggtct ctgaagagga cctggtgaca       900
     aagctcaatg ctggcttgca ggctgtgtcc gaggacccca ggcttctggt gagagccact       960
     ggagccagag aagcctcctc aagacctgag actgggccta atgacccccc aacaaccacc      1020
     cctgaggtgc ccaaggaaga agatgcccgg agggccctag tggactctgt gtttcaggtg      1080
     tctgtgctgc cgggcaatgt gggctacctg cgctttgaca gatttgcaga cgcctctgtg      1140
     ctgaggacgc tg                                                          1152
//


spacer
spacer