spacer

EBI Dbfetch

ID   AB033711; SV 1; linear; genomic DNA; STD; MUS; 1152 BP.
XX
AC   AB033711;
XX
DT   31-OCT-1999 (Rel. 61, Created)
DT   21-DEC-2000 (Rel. 66, Last updated, Version 3)
XX
DE   Mus musculus irbp gene for interphotoreceptor retinoid binding protein,
DE   partial cds.
XX
KW   interphotoreceptor retinoid binding protein.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1152
RA   Suzuki H., Serizawa K.;
RT   ;
RL   Submitted (19-OCT-1999) to the INSDC.
RL   Hitoshi Suzuki, Hokkaido University, Graduate School of Environmental Earth
RL   Sciences; North 10, West 5, Kita-ku, Sapporo 060-0810, Japan
RL   (E-mail:htsuzuki@ees.hokudai.ac.jp, Tel:81-11-706-2225(ex.2225),
RL   Fax:81-11-706-2225)
XX
RN   [2]
RX   DOI; 10.1023/A:1001828203201.
RX   PUBMED; 10862357.
RA   Serizawa K., Suzuki H., Tsuchiya K.;
RT   "A phylogenetic view on species radiation in Apodemus inferred from
RT   variation of nuclear and mitochondrial genes";
RL   Biochem. Genet. 38(1-2):27-40(2000).
XX
RN   [3]
RX   DOI; 10.1006/mpev.1999.0732.
RX   PUBMED; 10764531.
RA   Suzuki H., Tsuchiya K., Takezaki N.;
RT   "A molecular phylogenetic framework for the Ryukyu endemic rodents Tokudaia
RT   osimensis and Diplothrix legata";
RL   Mol. Phylogenet. Evol. 15(1):15-24(2000).
XX
DR   MD5; 3298bcffdeca5205caa03344179e7445.
DR   Ensembl-Gn; ENSMUSG00000041534; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035695; mus_musculus.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1152
FT                   /organism="Mus musculus"
FT                   /strain="MOA"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>1152
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:P49194"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="MGI:MGI:97878"
FT                   /protein_id="BAA85872.1"
FT                   /translation="AQVLTAGVQSSLSDPRLFISYEPSTLEAPQQAPVLTNLTREELLA
FT                   QIQRNIRHEVLEGNVGYLRVDDLPGQEVLSELGEFLVSHVWRQLMGTSSLVLDLRHCSG
FT                   GHFSGIPYVISYLHPGNTVMHVDTVYDRPSNTTTEIWTLPEVLGERYSADKDVVVLTSG
FT                   HTGGVAEDIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSNFFLTVPVSRSLGPLGGG
FT                   GQTWEGSGVLPCVGTPAEQALEKALAILTLRRALPGVVLRLQEALQDYYTLVDRVPGLL
FT                   HHLASMDYSAVVSEEDLVTKLNAGLQAVSEDPRLLVRATGPRDSSSRPETGPNESPAAT
FT                   PEVPTEEDARRALVDSVFQVSVLPGNVGYLRFDRFADAAVLETL"
XX
SQ   Sequence 1152 BP; 226 A; 347 C; 353 G; 226 T; 0 other;
     gcccaagtgc tgacagctgg agtccagagt tccttgagtg acccacgact cttcatctct        60
     tacgagccca gtaccctcga ggctccccag caagcaccag tgctcaccaa cctcacccga       120
     gaagaactgc tggcccagat acagaggaac atccgccatg aggttcttga gggcaatgtg       180
     ggctacctac gagtggatga cctccctggc caggaggtac tgagcgagct gggggagttc       240
     ttagtgagcc atgtgtggag gcagctcatg ggcacctcct ccttggtgct agatctccgg       300
     cactgctctg gcggccactt ctctgggatc ccttatgtca tctcttactt gcaccctggg       360
     aacacggtca tgcacgtgga caccgtctac gatcggccct ccaacaccac cacagagatc       420
     tggaccttgc ccgaggtcct cggggagaga tacagtgctg acaaggatgt ggtggtcctc       480
     accagtggac acactggggg agtcgcagag gacattgcct acatcctgaa gcagatgcgg       540
     cgcgccatcg tggtgggcga gcggacggag ggtggggccc tggacctcca gaagctgaga       600
     ataggccagt ccaacttctt cctcacagtg cctgtgtcca ggtccctggg acctctaggt       660
     ggaggtggcc agacatggga aggcagtggt gtgctgccct gtgtggggac ccctgcagag       720
     caagccctag aaaaggccct ggccatcctc accctgcgtc gtgccctgcc aggggttgtc       780
     ctccgacttc aggaagccct ccaggactat tacacattag tggaccgagt gccgggcctg       840
     ctgcaccacc tggccagcat ggactactca gctgtggtct ctgaagagga cctggtgaca       900
     aagctcaatg ctggcttgca ggctgtgtcg gaggatccca ggctcctggt gagggccacc       960
     ggacccagag actcctcctc aagacctgag actgggccta atgagtcccc agcagccacc      1020
     cccgaggtgc ccacggaaga agatgcccgg agggccctgg tggactctgt gtttcaggtg      1080
     tccgtgctgc cgggcaatgt gggctacctg cgctttgata gatttgcaga cgccgctgtg      1140
     ctggagacgc tg                                                          1152
//


spacer
spacer