spacer

EBI Dbfetch

ID   AB033710; SV 1; linear; genomic DNA; STD; ROD; 1152 BP.
XX
AC   AB033710;
XX
DT   31-OCT-1999 (Rel. 61, Created)
DT   21-DEC-2000 (Rel. 66, Last updated, Version 3)
XX
DE   Micromys minutus irbp gene for interphotoreceptor retinoid binding protein,
DE   partial cds.
XX
KW   interphotoreceptor retinoid binding protein.
XX
OS   Micromys minutus (European harvest mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Micromys.
XX
RN   [1]
RP   1-1152
RA   Suzuki H., Serizawa K.;
RT   ;
RL   Submitted (19-OCT-1999) to the INSDC.
RL   Hitoshi Suzuki, Hokkaido University, Graduate School of Environmental Earth
RL   Sciences; North 10, West 5, Kita-ku, Sapporo 060-0810, Japan
RL   (E-mail:htsuzuki@ees.hokudai.ac.jp, Tel:81-11-706-2225(ex.2225),
RL   Fax:81-11-706-2225)
XX
RN   [2]
RX   DOI; 10.1023/A:1001828203201.
RX   PUBMED; 10862357.
RA   Serizawa K., Suzuki H., Tsuchiya K.;
RT   "A phylogenetic view on species radiation in Apodemus inferred from
RT   variation of nuclear and mitochondrial genes";
RL   Biochem. Genet. 38(1-2):27-40(2000).
XX
RN   [3]
RX   DOI; 10.1006/mpev.1999.0732.
RX   PUBMED; 10764531.
RA   Suzuki H., Tsuchiya K., Takezaki N.;
RT   "A molecular phylogenetic framework for the Ryukyu endemic rodents Tokudaia
RT   osimensis and Diplothrix legata";
RL   Mol. Phylogenet. Evol. 15(1):15-24(2000).
XX
DR   MD5; 1d73d01bc72a58d5c5d53a215d4a2a51.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1152
FT                   /organism="Micromys minutus"
FT                   /isolate="HS1148/KT3068"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:13151"
FT   CDS             <1..>1152
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:Q9R0H9"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q9R0H9"
FT                   /protein_id="BAA85871.1"
FT                   /translation="AHVLTTGVQSSLNDPRLFISYEPSTLETPQQTAALTNLTREELLA
FT                   QLQGNIHHEVLEGNVGYLRMDDLPGQEILSELEEFLVNHVWKQLMGTSSLVLDLRNCAG
FT                   GHVSGIPYVISYFHPGNTVMHVDTVYDRPSNTTTEIWTLPKVLGERYSADKDVVVLTSG
FT                   HTGGVAEDIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSNFFLTVPVSRSLGPLGGG
FT                   GQTWEGSGVLPCVGIPAEQALEKALAILTLRRALPGVVLRLQEALQDYYTLVDRVPGLL
FT                   HHLASMDYSAVVSEEDLVTKLNAGLQAVSEDPRLLVRATGPRETSSRPETGPNDPPAAT
FT                   PEMPKEEAALRALVDSVFQVSVLPGNVGYLRFDSFADTSVLRIL"
XX
SQ   Sequence 1152 BP; 246 A; 337 C; 330 G; 239 T; 0 other;
     gcccatgtac tgacaactgg ggtacagagt tccttgaatg acccacgcct cttcatctcc        60
     tacgagccca gtaccctcga gactccccag caaacagcag cactcaccaa ccttacccga       120
     gaagaactgc tggcccagtt acaggggaac atccaccatg aggttcttga gggcaatgtg       180
     ggctacctac gcatggatga cctcccgggc caggagatac tgagtgagct ggaggagttc       240
     ctcgtgaacc atgtgtggaa gcagctcatg ggcacctcct ccttggtgct agatctccgg       300
     aactgcgctg gcggccatgt ctctgggatc ccttatgtca tctcttactt tcaccctggg       360
     aacactgtca tgcacgtgga caccgtctat gatcgtccct ccaacaccac cacagagatc       420
     tggaccttgc ccaaggtcct gggggagaga tacagtgctg acaaggatgt agtggtcctc       480
     accagtggac atacaggggg agtggctgaa gacatcgctt acatcctcaa gcagatgcgc       540
     agggccatcg tggtgggtga gcggacagag ggtggtgccc tggacctcca gaagctgaga       600
     ataggccagt ccaacttctt cctcacagta cctgtttcca ggtccctggg acccctaggt       660
     ggaggtggcc agacgtggga aggcagtgga gtgctgccct gtgtggggat acctgcagag       720
     caagccctag aaaaggcgct ggctatcctc accctgcgcc gtgccctgcc aggggttgtc       780
     cttcgacttc aggaagccct ccaggactat tacacgttag tggaccgagt gccaggcctg       840
     ctgcaccacc tggctagcat ggactactca gccgtggtct ctgaagagga cctggtgaca       900
     aagctcaacg ctggcttgca ggctgtgtca gaggatccta ggctcctggt gagagccact       960
     ggacccagag aaacctcctc aagacctgag actggtccta atgacccccc agcagccacc      1020
     cctgagatgc ccaaggaaga agctgccctg agggctctag tggactctgt gtttcaggtg      1080
     tctgtgctgc cgggcaatgt gggctacctg cgctttgaca gttttgcaga cacctctgtg      1140
     ctgaggatcc tg                                                          1152
//


spacer
spacer