spacer

EBI Dbfetch

ID   AB033706; SV 1; linear; genomic DNA; STD; ROD; 782 BP.
XX
AC   AB033706;
XX
DT   31-OCT-1999 (Rel. 61, Created)
DT   14-MAY-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Diplothrix legata irbp gene for interphotoreceptor retinoid binding
DE   protein, partial cds.
XX
KW   interphotoreceptor retinoid binding protein.
XX
OS   Diplothrix legata
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Diplothrix.
XX
RN   [1]
RP   1-782
RA   Suzuki H., Serizawa K.;
RT   ;
RL   Submitted (19-OCT-1999) to the INSDC.
RL   Hitoshi Suzuki, Hokkaido University, Graduate School of Environmental Earth
RL   Sciences; North 10, West 5, Kita-ku, Sapporo 060-0810, Japan
RL   (E-mail:htsuzuki@ees.hokudai.ac.jp, Tel:81-11-706-2225(ex.2225),
RL   Fax:81-11-706-2225)
XX
RN   [2]
RX   DOI; 10.1006/mpev.1999.0732.
RX   PUBMED; 10764531.
RA   Suzuki H., Tsuchiya K., Takezaki N.;
RT   "A molecular phylogenetic framework for the Ryukyu endemic rodents Tokudaia
RT   osimensis and Diplothrix legata";
RL   Mol. Phylogenet. Evol. 15(1):15-24(2000).
XX
DR   MD5; be4cdedb5580657ab05377ae99a8c8e5.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..782
FT                   /organism="Diplothrix legata"
FT                   /isolate="HS1163"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:106283"
FT   CDS             <1..>782
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:Q9R0I3"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q9R0I3"
FT                   /protein_id="BAA85867.1"
FT                   /translation="LHVDTIYDRPSNTTTEIWTLPKVLGERYSADKDVVVLTSGHTGGV
FT                   AEDIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSDFFLTVPVSRSLGPLGGGGQTWE
FT                   GSGVLPCVGIPAEQALEKALAILTLRRALPGVVLRLQEALQDYYTLVDRVPGLLHHLAS
FT                   MDYSAVVSEEDLVTKLNAGLQAVSEDPRLLVRATGPRETPSRPETGPNDPPAVTPEVPK
FT                   EEAARKALVDSVFQVSVLPGNVGYLRFDRFADASVLKTL"
XX
SQ   Sequence 782 BP; 164 A; 234 C; 241 G; 143 T; 0 other;
     ttgcacgtgg ataccatcta cgatcggccc tccaacacca ccacagagat ctggaccttg        60
     cctaaggtcc tgggggagag atacagtgct gacaaggatg tagtggtcct caccagtgga       120
     cacactgggg gagtagccga ggacatcgct tacatcctca agcagatgcg cagggccatc       180
     gtggtgggtg agcggacgga gggtggcgcc ctggacctcc agaagctgag aataggtcag       240
     tccgacttct tccttacagt gcctgtgtcc aggtccctgg ggcccctagg tggaggcggc       300
     caaacgtggg aaggcagcgg ggtgctgccc tgtgtgggaa tacctgcaga gcaagcccta       360
     gaaaaggccc tggccatcct caccctgcgt cgtgccctgc caggcgttgt cctccgactc       420
     caggaagccc tacaggacta ttacacatta gtggaccgag tgccgggcct gctgcaccac       480
     ctggccagca tggactactc ggccgtggtc tccgaagagg acctggtgac aaagctcaat       540
     gctggtttgc aggctgtgtc ggaggatccc aggctcctgg tgagagccac cggacccaga       600
     gaaaccccct caagacctga gactggccct aacgacccac cagcagtcac ccctgaggtg       660
     cccaaggaag aagctgccag gaaggcccta gtggactccg tgtttcaggt gtccgtgctg       720
     ccgggcaatg tgggctacct gcgctttgac agatttgcag acgcctccgt gctgaagaca       780
     ct                                                                      782
//


spacer
spacer