spacer

EBI Dbfetch

ID   AB033702; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AB033702;
XX
DT   31-OCT-1999 (Rel. 61, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Rattus rattus mitochondrial cytb gene for cytochrome b, partial cds.
XX
KW   cytochrome b.
XX
OS   Rattus rattus (black rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Rattus.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Suzuki H., Serizawa K.;
RT   ;
RL   Submitted (19-OCT-1999) to the INSDC.
RL   Hitoshi Suzuki, Hokkaido University, Graduate School of Environmental Earth
RL   Sciences; North 10, West 5, Kita-ku, Sapporo 060-0810, Japan
RL   (E-mail:htsuzuki@ees.hokudai.ac.jp, Tel:81-11-706-2225(ex.2225),
RL   Fax:81-11-706-2225)
XX
RN   [2]
RX   DOI; 10.1006/mpev.1999.0732.
RX   PUBMED; 10764531.
RA   Suzuki H., Tsuchiya K., Takezaki N.;
RT   "A molecular phylogenetic framework for the Ryukyu endemic rodents Tokudaia
RT   osimensis and Diplothrix legata";
RL   Mol. Phylogenet. Evol. 15(1):15-24(2000).
XX
DR   MD5; 9bfa670cf94426eda68921a707b64bb7.
DR   EuropePMC; PMC2490707; 18616808.
DR   EuropePMC; PMC3055845; 21324204.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Rattus rattus"
FT                   /organelle="mitochondrion"
FT                   /isolate="HS132/KT2833"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10117"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q9TDS3"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TDS3"
FT                   /protein_id="BAA85863.1"
FT                   /translation="MTNIRKSHPLIKIINHSFIDLPAPSNISSWWNFGSLLGVCLMVQI
FT                   ITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYY
FT                   GSYTFLETWNIGIILLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTIKDLLGVFMLLLFLMTLVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVVALVLSILILAFLPFLHTSKQRSLTFRPITQILYWILVANLFILTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGIIEDKMLKWN"
XX
SQ   Sequence 1140 BP; 355 A; 326 C; 139 G; 320 T; 0 other;
     atgacaaaca ttcgaaaatc acacccccta atcaaaatta ttaatcactc cttcattgac        60
     cttcccgccc catccaacat ctcatcatga tgaaattttg gctctcttct aggagtatgc       120
     cttatagttc aaattatcac aggcttattt ctagcaatac actacacatc cgacacttta       180
     acagcattct catcagttac tcacatctgc cgagacgtaa actacggctg actaatccga       240
     tacttacatg ccaacggagc ctcaatattc tttatctgct tattcctcca tgtaggccga       300
     gggatatact acggatccta caccttccta gaaacatgaa acattggaat tatcctacta       360
     tttgcagtca tagcaaccgc attcataggt tatgtactcc catgaggaca aatatcattc       420
     tgaggagcca cagtaatcac aaacctatta tcagccattc cctacattgg caccactcta       480
     gtcgaatgaa tctgaggagg cttctcagta gacaaagcaa ccctaacacg ttttttcgca       540
     ttccacttca tcctcccatt catcatcgcc gcccttgcaa ttgtacatct cctcttcctc       600
     cacgaaacag gatcaaacaa ccccacagga ctaaactctg acgcagacaa aatcccattc       660
     catccatact acacaattaa agacttactt ggagtgttca tactactcct atttctaata       720
     actctagtat tattcttccc agacttacta ggagacccag acaactacac acctgctaac       780
     ccactaaata ccccaccaca tattaagcca gaatggtatt tcctatttgc ctacgctatt       840
     ctacgctcca tccctaacaa attaggagga gtagtagcct tagtcctatc aattctaatc       900
     ttagcctttc taccattctt acatacctca aaacaacgca gcctaacatt ccgcccaatc       960
     acccaaattc tatactgaat tctagtagcc aacctcttca ttttaacatg aattgggggc      1020
     caaccagtag aacacccatt tattattatt ggccaactag catccatcag ttacttctca      1080
     attatcctta tcctaatacc aatctccgga atcattgaag acaaaatact aaaatgaaac      1140
//


spacer
spacer