spacer

EBI Dbfetch

ID   AB033696; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AB033696;
XX
DT   31-OCT-1999 (Rel. 61, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Diplothrix legata mitochondrial cytb gene for cytochrome b, partial cds.
XX
KW   cytochrome b.
XX
OS   Diplothrix legata
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Diplothrix.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Suzuki H., Serizawa K.;
RT   ;
RL   Submitted (19-OCT-1999) to the INSDC.
RL   Hitoshi Suzuki, Hokkaido University, Graduate School of Environmental Earth
RL   Sciences; North 10, West 5, Kita-ku, Sapporo 060-0810, Japan
RL   (E-mail:htsuzuki@ees.hokudai.ac.jp, Tel:81-11-706-2225(ex.2225),
RL   Fax:81-11-706-2225)
XX
RN   [2]
RX   DOI; 10.1006/mpev.1999.0732.
RX   PUBMED; 10764531.
RA   Suzuki H., Tsuchiya K., Takezaki N.;
RT   "A molecular phylogenetic framework for the Ryukyu endemic rodents Tokudaia
RT   osimensis and Diplothrix legata";
RL   Mol. Phylogenet. Evol. 15(1):15-24(2000).
XX
DR   MD5; 225d96bc5af2f697ef72031ea88a0db5.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Diplothrix legata"
FT                   /organelle="mitochondrion"
FT                   /isolate="HS1163"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:106283"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q9TDS9"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TDS9"
FT                   /protein_id="BAA85857.1"
FT                   /translation="MANIRKSHPLIKIINHSFIDLPAPSNISSWWNFGSLLGVCLMVQI
FT                   ITGLFLAMHYTSDTTTAFSSVAHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGMYY
FT                   GSYTFLETWNIGIILLFTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIAALAIVHLLFLHETGSNNPTGLDSNADKIPFHP
FT                   YYTIKDLLGVFMLLLLLMTLVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVVALVLSILILAFLPFLHTSKQRSLTFRPITQTLYWILVANLLILTWIGG
FT                   QPVEHPFIIIGQLASMSYFSIILILMPISGIIEDKMLKWN"
XX
SQ   Sequence 1140 BP; 353 A; 341 C; 141 G; 305 T; 0 other;
     atggcaaaca ttcgaaaatc ccaccctcta atcaaaatta ttaaccactc tttcatcgac        60
     ctccccgccc catccaacat ctcatcatga tgaaactttg gctctctcct aggagtatgc       120
     cttatagttc aaattatcac aggtctattc ctagcaatac actacacatc tgacactact       180
     acagcattct catcagtcgc ccacatctgc cgagatgtaa actacggctg actaatccga       240
     tatatacatg ccaacggagc ctcaatattt tttatctgct tattccttca cgtaggacga       300
     gggatatact atggatccta taccttccta gaaacatgaa acattggaat catcctacta       360
     ttcacagtca tagcaaccgc attcataggc tatgtacttc catgaggaca aatatccttc       420
     tgaggggcta cagtaatcac aaacctgcta tcagccatcc cctacatcgg aactacatta       480
     gttgaatgaa tttgaggcgg tttctcagta gacaaagcaa ccctaacacg ttttttcgca       540
     ttccacttca tcctcccatt tattatcgcc gctcttgcaa ttgtacacct ccttttcctc       600
     cacgaaacag gatcaaataa ccccacagga ctagattcca acgcagacaa aatcccattt       660
     cacccctact atacaatcaa agatctccta ggagtattca tactactcct acttctaata       720
     accctagtac tattctttcc agacctacta ggagacccag acaactacac acccgctaac       780
     cccctaaaca ccccgccaca cattaaacca gaatggtact tcctcttcgc ttacgccatt       840
     ctacgctcta tccccaacaa actaggagga gtcgtagccc tagtcctatc aattctaatc       900
     ctagccttcc taccattctt acacacctca aaacaacgca gcctaacatt ccgcccaatc       960
     actcaaactc tatactgaat cctagtagcc aacctactca ttttaacatg aattggagga      1020
     caaccagtag aacatccatt catcattatt ggccaactag catccatgag ttacttctca      1080
     atcatcctta tcctaatacc aatctctgga atcatcgaag acaaaatact aaaatgaaat      1140
//


spacer
spacer