spacer

EBI Dbfetch

ID   AB032863; SV 1; linear; genomic DNA; STD; ROD; 1152 BP.
XX
AC   AB032863;
XX
DT   11-OCT-1999 (Rel. 61, Created)
DT   21-DEC-2000 (Rel. 66, Last updated, Version 3)
XX
DE   Apodemus sylvaticus irbp gene for interphotoreceptor retinoid binding
DE   protein, partial cds.
XX
KW   interphotoreceptor retinoid binding protein.
XX
OS   Apodemus sylvaticus (European woodmouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Apodemus; Sylvaemus group.
XX
RN   [1]
RP   1-1152
RA   Suzuki H., Serizawa K.;
RT   ;
RL   Submitted (30-SEP-1999) to the INSDC.
RL   Keiko Serizawa, Hokkaido University, Graduate School of Environmental Earth
RL   Sciences; North 10, West 5, Kita-ku, Sapporo 060-0810, Japan
RL   (E-mail:serizawa@ees.hokudai.ac.jp, Tel:81-11-706-2225(ex.2225),
RL   Fax:81-11-706-2225)
XX
RN   [2]
RX   DOI; 10.1006/mpev.1999.0732.
RX   PUBMED; 10764531.
RA   Suzuki H., Tsuchiya K., Takezaki N.;
RT   "A molecular phylogenetic framework for the Ryukyu endemic rodents Tokudaia
RT   osimensis and Diplothrix legata";
RL   Mol. Phylogenet. Evol. 15(1):15-24(2000).
XX
RN   [3]
RX   DOI; 10.1023/A:1001828203201.
RX   PUBMED; 10862357.
RA   Serizawa K., Suzuki H., Tsuchiya K.;
RT   "A phylogenetic view on species radiation in Apodemus inferred from
RT   variation of nuclear and mitochondrial genes";
RL   Biochem. Genet. 38(1-2):27-40(2000).
XX
DR   MD5; 113984ecaed1ea99c5c610a677d5f9b5.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1152
FT                   /organism="Apodemus sylvaticus"
FT                   /isolate="HS1290"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10129"
FT   CDS             <1..>1152
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:Q9R0I9"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q9R0I9"
FT                   /protein_id="BAA85224.1"
FT                   /translation="ARVLTAGVQSSLNDPRLFISYEPSSLETPQQAPALTNLTREELLA
FT                   QVQRNIHHEVLEGNVGYLRVDDLPGQEVLSELGEFLVSHVWKQLMGTSSLVLDLRHCTG
FT                   GHVSGIPYVISYLHPGNTVMHVDTIYDRPSNTTTEIWTLPKVLGERYSADKDVVILTSG
FT                   HTGGVAEDIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSNFFLTVPVSRSLGPLGGG
FT                   GQTWEGSGVLPCVRTPAEQALEKALAILTLRRALPGVVLRLQEALQDYYTLVDRVPGLL
FT                   HHLASMDYSTVVSEEDLVTKLNAGLQAVSEDPRLLVRATGPREASSRPESGPNEPPEAT
FT                   PEVPKEEDARRALVDSVFQVSVLPGNVGYLRFDRFADASVLRTL"
XX
SQ   Sequence 1152 BP; 237 A; 343 C; 345 G; 227 T; 0 other;
     gcccgcgtgc tgacggctgg agtacagagc tccttgaatg acccacgtct cttcatctct        60
     tatgagccca gtagcctcga gactccccag caagcgccag cgctcaccaa cctcacccga       120
     gaagaactgc tggcccaggt acagaggaac attcaccatg aggtgcttga gggcaacgtg       180
     ggctacctac gggtggatga cctccctggc caggaggtac tgagtgagct gggggagttc       240
     ttagtgagcc atgtgtggaa gcagctcatg ggcacctcct ccttggtgct agatctccgg       300
     cactgcactg gcggccacgt ctctgggatc ccttatgtca tctcttactt gcaccctggg       360
     aacactgtca tgcacgtgga taccatctac gatcgtccct ccaacaccac cacagagatc       420
     tggaccttgc ccaaggtcct aggggagaga tacagtgctg acaaggacgt ggtgatcctc       480
     accagtggac acaccggggg agtcgctgaa gacatcgcct acatcctcaa gcagatgcgc       540
     agggccattg tggtgggtga gcggacggag ggtggagccc tggacctcca gaagctgaga       600
     ataggccagt ccaacttctt cctcacagtg cctgtgtcca ggtccctggg acccctgggt       660
     ggaggcggcc agacgtggga aggcagtgga gtgctgccct gtgtgaggac acctgcagag       720
     caagccctag agaaggccct ggccatcctc actctgcgcc gagccctgcc tggggttgtc       780
     ctccgacttc aggaagccct ccaggactat tacacattag tggaccgagt gccgggcctg       840
     ctgcaccacc tggctagcat ggactactca accgtggtct ctgaagagga cctggtgaca       900
     aagctcaacg ctggcttgca ggctgtgtcg gaggacccca ggctcctggt gagagccact       960
     ggacccagag aagcctcctc aagacctgag tctgggccta atgaaccccc agaagccacc      1020
     cctgaggtgc ccaaggaaga agatgcccga agggcccttg tggactctgt gtttcaggtg      1080
     tccgtgctgc cgggcaatgt gggctacctg cgctttgata gatttgcaga tgcttctgtg      1140
     ctgaggaccc tg                                                          1152
//


spacer
spacer