spacer

EBI Dbfetch

ID   AB032856; SV 1; linear; genomic DNA; STD; ROD; 1152 BP.
XX
AC   AB032856;
XX
DT   15-OCT-1999 (Rel. 61, Created)
DT   21-DEC-2000 (Rel. 66, Last updated, Version 2)
XX
DE   Apodemus speciosus irbp gene for interphotoreceptor retinoid binding
DE   protein, partial cds, isolate:HS240.
XX
KW   interphotoreceptor retinoid binding protein.
XX
OS   Apodemus speciosus (large Japanese field mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Apodemus.
XX
RN   [1]
RP   1-1152
RA   Serizawa K., Suzuki H.;
RT   ;
RL   Submitted (29-SEP-1999) to the INSDC.
RL   Keiko Serizawa, Hokkaido University, Graduate School of Environmental Earth
RL   Sciences; North 10, West 5, Kita-ku, Sapporo 060-0810, Japan
RL   (E-mail:serizawa@ees.hokudai.ac.jp, Tel:81-11-706-2225(ex.2225),
RL   Fax:81-11-706-2225)
XX
RN   [2]
RX   DOI; 10.1023/A:1001828203201.
RX   PUBMED; 10862357.
RA   Serizawa K., Suzuki H., Tsuchiya K.;
RT   "A phylogenetic view on species radiation in Apodemus inferred from
RT   variation of nuclear and mitochondrial genes";
RL   Biochem. Genet. 38(1-2):27-40(2000).
XX
DR   MD5; f2eba2e48f8dfc34ceaa229e57e8d652.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1152
FT                   /organism="Apodemus speciosus"
FT                   /isolate="HS240"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:105296"
FT   CDS             <1..>1152
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="irbp"
FT                   /product="interphotoreceptor retinoid binding protein"
FT                   /db_xref="GOA:Q9R0J6"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q9R0J6"
FT                   /protein_id="BAA85242.1"
FT                   /translation="AQVLTAGVQSSLNDPRLFISYEPSSLEAPQQAPALTNLTREELLA
FT                   QIQRNIHHEVLEGNVGYLRVDDLPGQEVLSELGEFLVNHVWKQLMSTSSLVLDLRHCAG
FT                   GHVSGIPYVISYLHPGNTVMHVDTIYDRPSNTTTEIWTLPKVLGERYSADKDVVVLTSG
FT                   HTGGVAEDIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSNFFLTVPVSRSLGPLGGG
FT                   GQTWEGSGVLPCVGTPAEQALEKALAILTLRRALPGVVLRLQEALQDYYTLVDRVPGLL
FT                   HHLASMDYSTVVSEEDLVTKLNAGLQAVSEDPRLLVRATGPREASSRPESGPNDPPAAT
FT                   PEVPKEEDARRALVDSVFQVAVLPGNVGYLRFDSFADASVLRIL"
XX
SQ   Sequence 1152 BP; 233 A; 347 C; 346 G; 226 T; 0 other;
     gcccaagtgc tgacggctgg agtacagagc tccttgaacg acccacgtct cttcatctct        60
     tatgagccca gtagcctgga ggctccccag caagccccag cactcaccaa cctcacccga       120
     gaagaactgc tggcccagat acagaggaac atccaccatg aggtgcttga gggcaacgtg       180
     ggctacctgc gggtggatga cctccctggc caggaggtac tgagtgagct gggggagttc       240
     ttagtgaacc atgtgtggaa gcagctcatg agcacctcct ccttggtgct cgatctccgg       300
     cactgtgctg gcggccacgt ctctgggatc ccttatgtca tctcttactt gcaccctggg       360
     aacactgtca tgcatgtaga taccatctac gatcgcccct ccaacaccac cacggagatc       420
     tggaccttgc ccaaggtcct aggggagaga tacagtgctg acaaggacgt ggtggtcctc       480
     accagtggac ataccggggg agtcgcagag gacatcgcct acatcctcaa gcagatgcgc       540
     agggccatcg tggtgggtga gcggaccgag ggtggcgccc tggacctcca gaagctgaga       600
     ataggccagt ccaacttctt cctcacagtg cctgtgtcca ggtccctggg acccctgggt       660
     ggaggcggcc agacgtggga gggcagtgga gtgctaccct gtgtggggac gcctgcagaa       720
     caagccctag agaaggctct ggccatcctc actctgcgtc gggccctgcc tggagttgtc       780
     ctccgacttc aggaagccct ccaggactat tacacattag tggaccgagt gccgggcctg       840
     ctgcaccacc tggctagcat ggactactca accgtggtct ctgaagagga cctggtgaca       900
     aagctcaatg ctggcttgca ggctgtgtcg gaggatccca ggctcctggt gagagccact       960
     ggacccagag aagcctcctc aagacctgag tctgggccta atgacccccc agcagccacc      1020
     cctgaggtgc ccaaggaaga agatgcccga agggcccttg tggactctgt gtttcaggtg      1080
     gccgtgctgc cgggcaatgt gggctacctg cgctttgaca gcttcgcaga tgcctctgtg      1140
     ctgaggatcc tg                                                          1152
//


spacer
spacer