spacer

EBI Dbfetch

ID   AB032853; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AB032853;
XX
DT   15-OCT-1999 (Rel. 61, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Apodemus flavicollis mitochondrial cytb gene for cytochrome b, partial cds,
DE   isolate:HS591.
XX
KW   cytochrome b.
XX
OS   Apodemus flavicollis (Yellow-necked field mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Apodemus; Sylvaemus group.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Serizawa K., Suzuki H.;
RT   ;
RL   Submitted (29-SEP-1999) to the INSDC.
RL   Keiko Serizawa, Hokkaido University, Graduate School of Environmental Earth
RL   Sciences; North 10, West 5, Kita-ku, Sapporo 060-0810, Japan
RL   (E-mail:serizawa@ees.hokudai.ac.jp, Tel:81-11-706-2225(ex.2225),
RL   Fax:81-11-706-2225)
XX
RN   [2]
RX   DOI; 10.1023/A:1001828203201.
RX   PUBMED; 10862357.
RA   Serizawa K., Suzuki H., Tsuchiya K.;
RT   "A phylogenetic view on species radiation in Apodemus inferred from
RT   variation of nuclear and mitochondrial genes";
RL   Biochem. Genet. 38(1-2):27-40(2000).
XX
DR   MD5; 143e851ec7054d48116383f0c387af7e.
DR   EuropePMC; PMC2490707; 18616808.
DR   EuropePMC; PMC2567236; 18854415.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Apodemus flavicollis"
FT                   /organelle="mitochondrion"
FT                   /isolate="HS591"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:54292"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cyt b"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q9TDX2"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TDX2"
FT                   /protein_id="BAA85239.1"
FT                   /translation="MTNIRKTHPLLKIINHSFIDLPAPSNISSWWNFGSLLGICLMIQI
FT                   LTGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYLHANGASMFFICLFLHVGRGMYY
FT                   GSYTFMETWNIGVILLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIAALVIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTIKDILGVLMMASFLMTLVLFFPDLLGDPDNYMPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILALLPFLHTSKQRSLMFRPITQTLYWILVANLLVLTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGIIEDKMLKWN"
XX
SQ   Sequence 1140 BP; 360 A; 309 C; 140 G; 331 T; 0 other;
     atgacaaaca ttcgaaaaac acacccccta ctaaaaatta ttaatcactc tttcatcgac        60
     ttaccagccc catccaatat ctcatcatga tgaaactttg gctccctctt aggaatctgc       120
     ctaataatcc aaatccttac aggtctattt ctagcaatac actatacatc agacacaata       180
     acagcattct cttcagtaac tcatatctgc cgagacgtaa attatggatg attaattcga       240
     tatttacacg caaacggagc ctcaatattc ttcatttgct tatttctaca cgtaggacga       300
     ggaatatatt acggatcata caccttcata gaaacatgaa acatcggtgt aattctccta       360
     ttcgcagtaa tagccacagc attcataggt tatgtccttc catgaggaca aatatccttc       420
     tgaggggcaa cagtaattac aaatctatta tcagcaattc catacatcgg aactacccta       480
     gtagagtgaa tctgaggagg attctcagta gataaagcta cactaacacg tttcttcgcc       540
     ttccacttta tcttaccatt catcattgcc gccctagtaa tcgttcatct cctatttctc       600
     catgaaactg ggtcaaataa ccccacaggc cttaactcag acgccgacaa aattccattt       660
     cacccgtact atacaattaa agacattcta ggagtactca taatagcgtc attcctaata       720
     accttagttc tcttcttccc agaccttcta ggtgacccgg acaactatat acctgccaac       780
     ccactaaata ccccaccaca cattaaacca gaatggtact tcctatttgc atacgcaatt       840
     ctacgatcca tccctaacaa attaggtgga gtcctagccc taattttatc tatccttatt       900
     ctagccctat taccattcct ccacacctct aaacaacgca gcctaatatt ccgtccaatc       960
     actcaaaccc tatactgaat cctagttgct aaccttctcg tcctaacttg aattggaggt      1020
     caaccagtag aacacccatt tatcatcatt ggccaactag cctcaatcag ctacttctct      1080
     attattctaa tcctcatacc catctcaggc attattgaag ataaaatatt aaaatgaaac      1140
//


spacer
spacer