spacer

EBI Dbfetch

ID   AB032849; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AB032849;
XX
DT   15-OCT-1999 (Rel. 61, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Apodemus speciosus mitochondrial cytb gene for cytochrome b, partial cds,
DE   isolate:HS240.
XX
KW   cytochrome b.
XX
OS   Apodemus speciosus (large Japanese field mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Apodemus.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RA   Serizawa K., Suzuki H.;
RT   ;
RL   Submitted (29-SEP-1999) to the INSDC.
RL   Keiko Serizawa, Hokkaido University, Graduate School of Environmental Earth
RL   Sciences; North 10, West 5, Kita-ku, Sapporo 060-0810, Japan
RL   (E-mail:serizawa@ees.hokudai.ac.jp, Tel:81-11-706-2225(ex.2225),
RL   Fax:81-11-706-2225)
XX
RN   [2]
RX   DOI; 10.1023/A:1001828203201.
RX   PUBMED; 10862357.
RA   Serizawa K., Suzuki H., Tsuchiya K.;
RT   "A phylogenetic view on species radiation in Apodemus inferred from
RT   variation of nuclear and mitochondrial genes";
RL   Biochem. Genet. 38(1-2):27-40(2000).
XX
DR   MD5; 3e015af6eca6f03cc1a670a1d37710e9.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Apodemus speciosus"
FT                   /organelle="mitochondrion"
FT                   /isolate="HS240"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:105296"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q9TDX6"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TDX6"
FT                   /protein_id="BAA85235.1"
FT                   /translation="MTNIRKTHPLFKIVNHSFIDLPAPSNISSWWNFGSLLGICLVIQI
FT                   ITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWLIRYMHANGASMFFICLFLHVGRGMYY
FT                   GSYMFMETWNIGVILLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGSTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIITAMVIVHLLFLHETGSNNPTGLNSDADKIPFHP
FT                   YYTIKDILGILIMIMFLMTLVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILVLALLPFLHTSKQRSLMFRPITQTLYWILVANLFVLTWIGG
FT                   QPVEHPFVIIGQLASISYFSIILILMPISGIIEDKMLKLN"
XX
SQ   Sequence 1140 BP; 364 A; 301 C; 139 G; 336 T; 0 other;
     atgacaaaca tccgaaaaac acacccatta ttcaagatcg ttaaccactc cttcatcgac        60
     ctccctgccc catctaacat ctcatcctga tgaaatttcg gctctctcct aggcatttgc       120
     ctcgtaatcc aaattattac aggcctattt ttagctatac actatacatc agacacaata       180
     acagcattct catcagtaac tcatatctgc cgagacgtaa actatggatg acttatccga       240
     tacatacatg caaatggagc ttcaatattc ttcatctgtt tatttctcca cgtaggacga       300
     ggaatatatt atggatccta tatatttata gagacatgaa acattggagt aatcctttta       360
     ttcgcagtaa tagccacagc attcataggt tatgtacttc catgaggaca aatatccttc       420
     tgaggggcaa cagtaattac aaatctactt tcagctatcc catatattgg ctccacccta       480
     gtagaatgaa tctgaggagg cttctcagta gataaagcaa cactaacacg cttcttcgca       540
     ttccacttca ttctcccatt cattatcaca gctatagtta ttgttcactt actattcctt       600
     cacgaaacag gctcaaacaa cccaacagga ttaaactcag atgccgacaa aatcccattc       660
     cacccatatt atacaattaa agacattcta gggattctta ttataattat atttctaata       720
     actctagttc tattcttccc agacctacta ggagacccag acaactatac accagcaaat       780
     ccactcaata ccccacccca tattaagcca gaatggtatt ttctatttgc ttacgcaatt       840
     cttcgctcaa tcccaaacaa actaggaggt gttctagcct taatcctatc aattctagtt       900
     ctagctcttc tcccatttct ccacacttca aaacaacgaa gcctaatatt tcgcccaatt       960
     acacaaacac tctactgaat cctagtagcc aatctctttg tcttaacctg aatcggaggc      1020
     caaccagtag aacacccatt cgtaatcatt ggccaactag cctctatcag ctatttctcc      1080
     attatcctca tcctaatacc aatctcagga atcattgaag acaaaatact aaaattaaac      1140
//


spacer
spacer