Dbfetch

ID   AB032599; SV 1; linear; genomic DNA; STD; HUM; 546 BP.
XX
AC   AB032599;
XX
DT   28-SEP-1999 (Rel. 61, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-B61V(B*4002V2) gene for MHC class I antigen, partial cds.
XX
KW   HLA-B; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Juji T., Akesaka T., Kashiwase K., Ishikawa Y.;
RT   ;
RL   Submitted (21-SEP-1999) to the INSDC.
RL   Takeo Juji, Japanese Red Cross Central Blood Center, Research; 4-1-31,
RL   Shibuya 150-0012, Japan (E-mail:kasiwase@hla.cbc.jrc.or.jp,
RL   Tel:+81-3406-1211, Fax:+81-3406-7892)
XX
RN   [2]
RP   1-546
RA   Juji T., Akesaka T., Kashiwase K., Ishikawa Y.;
RT   "HLA-B4002V2";
RL   Unpublished.
XX
DR   MD5; fc46a778245664249dd38e095e8c4bf4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A24/26,B52/61V(B*4002V2),Cw10/12"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="allele:HLA-B61V(B*4002V2)"
FT                   /db_xref="GOA:Q9TPQ1"
FT                   /db_xref="IMGT/HLA:B*40:29"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TPQ1"
FT                   /protein_id="BAA84647.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDPETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRA"
XX
SQ   Sequence 546 BP; 112 A; 175 C; 189 G; 70 T; 0 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     acccggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac cctccagagc atgtacggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagtacgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctgc gctcctggac cgccgcggac acggcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagctgaga gcctacctgg       480
     agggcgagtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//