spacer

EBI Dbfetch

ID   AB032598; SV 1; linear; genomic DNA; STD; HUM; 531 BP.
XX
AC   AB032598;
XX
DT   28-SEP-1999 (Rel. 61, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-B1301V1(HLA-null) gene for MHC class I antigen, partial
DE   cds.
XX
KW   HLA-B; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-531
RA   Juji T., Akesaka T., Kashiwase K., Ishikawa Y.;
RT   ;
RL   Submitted (21-SEP-1999) to the INSDC.
RL   Takeo Juji, Japanese Red Cross Central Blood Center, Research; 4-1-31,
RL   Shibuya 150-0012, Japan (E-mail:kasiwase@hla.cbc.jrc.or.jp,
RL   Tel:+81-3406-1211, Fax:+81-3406-7892)
XX
RN   [2]
RP   1-531
RA   Juji T., Akesaka T., Kashiwase K., Ishikawa Y.;
RT   "HLA-B1301V1(HLA-null)";
RL   Unpublished.
XX
DR   MD5; af13345b93ffff3f7bb65f86f51ffdf8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..531
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A26(A*2601)/A11,B62(B*1501)/blank,
FT                   DRB1*0901/1212"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>531
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="allele:HLA-B1301V1(HLA-null)"
FT                   /db_xref="GOA:Q9TPQ2"
FT                   /db_xref="IMGT/HLA:B*13:07N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TPQ2"
FT                   /protein_id="BAA84646.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFITVGYVDDTQFVRFDSDATSPRMA
FT                   PRAPWIEQEGPEYWVSKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDLGPDGRLL
FT                   RGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQLKWEAARVAEQLRAYLEGECVEWLR
FT                   RYLENGKETLQRA"
XX
SQ   Sequence 531 BP; 108 A; 170 C; 179 G; 74 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     tctccaagac caacacacag acttaccgag agaacctgcg caccgcgctc cgctactaca       240
     accagagcga ggccgggtct cacatcatcc agaggatgta tggctgcgac ctggggccgg       300
     acgggcgcct cctccgcggg cataaccagt tagcctacga cggcaaggat tacatcgccc       360
     tgaacgagga cctgagctcc tggaccgcgg cggacaccgc ggctcagatc acccagctca       420
     agtgggaggc ggcccgtgtg gcggagcagc tgagagccta cctggagggc gagtgcgtgg       480
     agtggctccg cagatacctg gagaacggga aggagacgct gcagcgcgcg g                531
//


spacer
spacer