spacer

EBI Dbfetch

ID   AB032597; SV 1; linear; genomic DNA; STD; HUM; 546 BP.
XX
AC   AB032597;
XX
DT   28-SEP-1999 (Rel. 61, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens HLA-A31(A*31012V1) gene for MHC class I antigen, partial cds.
XX
KW   HLA-A; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Juji T., Akesaka T., Kashiwase K., Ishikawa Y.;
RT   ;
RL   Submitted (21-SEP-1999) to the INSDC.
RL   Takeo Juji, Japanese Red Cross Central Blood Center, Research; 4-1-31,
RL   Shibuya 150-0012, Japan (E-mail:kasiwase@hla.cbc.jrc.or.jp,
RL   Tel:+81-3406-1211, Fax:+81-3406-7892)
XX
RN   [2]
RP   1-546
RA   Juji T., Akesaka T., Kashiwase K., Ishikawa Y.;
RT   "HLA-A31012V1";
RL   Unpublished.
XX
DR   MD5; b63ea978973e81da62b441cacba968c5.
DR   Ensembl-Gn; ENSG00000231834; homo_sapiens.
DR   Ensembl-Tr; ENST00000456012; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A2(A*0207)/A31(A*31012V1),B39/46,Cw1/7"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /note="allele:HLA-A31(A*31012V1)"
FT                   /db_xref="GOA:P16189"
FT                   /db_xref="HGNC:HGNC:4931"
FT                   /db_xref="IMGT/HLA:A*31:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P16189"
FT                   /protein_id="BAA84645.1"
FT                   /translation="SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQERPEYWDQETRNVKAHSQIDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGS
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VDGLRRYLENGKETLQRT"
XX
SQ   Sequence 546 BP; 108 A; 163 C; 196 G; 79 T; 0 other;
     gctcccactc catgaggtat ttcaccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagaggcct gagtattggg       180
     accaggagac acggaatgtg aaggcccact cacagattga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg gttctcacac catccagatg atgtatggct       300
     gcgacgtggg gtcggacggg cgcttcctcc gcgggtacca gcaggacgcc tacgacggca       360
     aggattacat cgccttgaac gaggacctgc gctcttggac cgcggcggac atggcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagttgaga gcctacctgg       480
     agggcacgtg cgtggacggg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcacgg                                                                  546
//


spacer
spacer