spacer

EBI Dbfetch

ID   AB032594; SV 1; linear; genomic DNA; STD; HUM; 546 BP.
XX
AC   AB032594;
XX
DT   28-SEP-1999 (Rel. 61, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens HLA-A2(A*0201V2) gene for MHC class I antigen, partial cds.
XX
KW   HLA-A; MHC class I antigen.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Juji T., Akesaka T., Kashiwase K., Ishikawa Y.;
RT   ;
RL   Submitted (21-SEP-1999) to the INSDC.
RL   Takeo Juji, Japanese Red Cross Central Blood Center, Research; 4-1-31,
RL   Shibuya 150-0012, Japan (E-mail:kasiwase@hla.cbc.jrc.or.jp,
RL   Tel:+81-3406-1211, Fax:+81-3406-7892)
XX
RN   [2]
RP   1-546
RA   Juji T., Akesaka T., Kashiwase K., Ishikawa Y.;
RT   "HLA-A0201V3";
RL   Unpublished.
XX
DR   MD5; 801a972e5082cb72485f2625b4c3ee0a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /note="HLA-A2(A*0201V2)/11.1,B62/70,Cw4/7,DRB1*0401/0406"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /note="allele:HLA-A2(A*0201V2)"
FT                   /db_xref="GOA:Q9TPQ6"
FT                   /db_xref="IMGT/HLA:A*02:42"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q9TPQ6"
FT                   /protein_id="BAA84642.2"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
XX
SQ   Sequence 546 BP; 111 A; 161 C; 193 G; 81 T; 0 other;
     gctctcactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagggtccg gagtattggg       180
     acggggagac acggaaagtg aaggcccact cacagactca ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg gttctcacac cgtccagagg atgtatggct       300
     gcgacgtggg gtcggactgg cgcttcctcc gcgggtacca ccagtacgcc tacgacggca       360
     aggattacat cgccctgaaa gaggacctgc gctcttggac cgcggcggac atggcagctc       420
     agaccaccaa gcacaagtgg gaggcggccc atgtggcgga gcagttgaga gcctacctgg       480
     agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcacgg                                                                  546
//


spacer
spacer