spacer

EBI Dbfetch

ID   AB015600; SV 1; linear; genomic DNA; STD; HUM; 822 BP.
XX
AC   AB015600;
XX
DT   22-JUN-1998 (Rel. 56, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MICA gene, partial cds.
XX
KW   MICA.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-822
RA   Ishikawa Y., Wakui M.K.;
RT   ;
RL   Submitted (15-JUN-1998) to the INSDC.
RL   Yoshihide Ishikawa, Japanese Red Cross Central Blood Center, Department of
RL   Research; 4-1-31 Hiroo, Shibuya-Ku, Tokyo 150-0012, Japan
RL   (E-mail:ishikawa@hla.cbc.jrc.or.jp, Tel:+81-3-3406-1211,
RL   Fax:+81-3-3406-7892)
XX
RN   [2]
RX   DOI; 10.1007/s002510050658.
RX   PUBMED; 10369920.
RA   Komatsu-Wakui M., Tokunaga K., Ishikawa Y., Kashiwase K., Moriyama S.,
RA   Tsuchiya N., Ando H., Shiina T., Geraghty D.E., Inoko H., Juji T.;
RT   "MIC-A polymorphism in Japanese and a MIC-A-MIC-B null haplotype";
RL   Immunogenetics 49(7-8):620-628(1999).
XX
DR   MD5; 1ab7089f433160db3331584dc3d67efc.
DR   Ensembl-Gn; ENSG00000183214; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235233; homo_sapiens.
DR   Ensembl-Tr; ENST00000400325; homo_sapiens.
DR   Ensembl-Tr; ENST00000418465; homo_sapiens.
DR   Ensembl-Tr; ENST00000547609; homo_sapiens.
DR   IMGT/LIGM; AB015600.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..822
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>822
FT                   /codon_start=1
FT                   /gene="MICA"
FT                   /db_xref="GOA:Q29983"
FT                   /db_xref="HGNC:HGNC:7090"
FT                   /db_xref="IMGT/HLA:MICA*019"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1B3J"
FT                   /db_xref="PDB:1HYR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29983"
FT                   /protein_id="BAA29034.1"
FT                   /translation="EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKP
FT                   QGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNST
FT                   RSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHAD
FT                   CLQELRRYLESSVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVS
FT                   LSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPS"
XX
SQ   Sequence 822 BP; 214 A; 220 C; 233 G; 155 T; 0 other;
     gagccccaca gtcttcgtta taacctcacg gtgctgtcct gggatggatc tgtgcagtca        60
     gggtttcttg ctgaggtaca tctggatggt cagcccttcc tgcgctatga caggcagaaa       120
     tgcagggcaa agccccaggg acagtgggca gaagatgtcc tgggaaataa gacatgggac       180
     agagagacca gggacttgac agggaacgga aaggacctca ggatgaccct ggctcatatc       240
     aaggaccaga aagaaggctt gcattccctc caggagatta gggtctgtga gatccatgaa       300
     gacaacagca ccaggagctc ccagcatttc tactacgatg gggagctctt cctctcccaa       360
     aacctggaga ctgaggaatg gacagtgccc cagtcctcca gagctcagac cttggccatg       420
     aacgtcagga atttcttgaa ggaagatgcc atgaagacca agacacacta tcacgctatg       480
     catgcagact gcctgcagga actacggcga tatctagaat ccagcgtagt cctgaggaga       540
     acagtgcccc ccatggtgaa tgtcacccgc agcgaggcct cagagggcaa catcaccgtg       600
     acatgcaggg cttccagctt ctatccccgg aatatcatac tgacctggcg tcaggatggg       660
     gtatctttga gccacgacac ccagcagtgg ggggatgtcc tgcctgatgg gaatggaacc       720
     taccagacct gggtggccac caggatttgc cgaggagagg agcagaggtt cacctgctac       780
     atggaacaca gcgggaatca cagcactcac cctgtgccct ct                          822
//


spacer
spacer