spacer

EBI Dbfetch

ID   AB008102; SV 1; linear; mRNA; STD; HUM; 1093 BP.
XX
AC   AB008102;
XX
DT   29-OCT-1997 (Rel. 53, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens mRNA for HLA-B*5801, complete cds.
XX
KW   HLA-B*5801.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1093
RA   Ogawa A.;
RT   ;
RL   Submitted (13-OCT-1997) to the INSDC.
RL   Atsuko Ogawa, Japanese Red Cross Central Blood Center, 1st Research
RL   Section; Hiroo 4-1-31, Shibuya-ku, Tokyo 150-0012, Japan
RL   (E-mail:ogawa@info.cbc.jrc.or.jp, Tel:81-3-5485-6009, Fax:81-3-3406-7892)
XX
RN   [2]
RX   DOI; 10.1034/j.1399-0039.1999.530603.x.
RX   PUBMED; 10395103.
RA   Inoue T., Ogawa A., Tokunaga K., Ishikawa Y., Kashiwase K., Tanaka H.,
RA   Park M.H., Jia G.J., Chimge N.-O., Sideltseva E.W., Akaza T., Tadokoro K.,
RA   Takahashi T., Juji T.;
RT   "Diversity of HLA-B17 alleles and haplotypes in East Asians and a novel Cw6
RT   allele (Cw*0604) associated with B*5701";
RL   Tissue Antigens 53(6):534-544(1999).
XX
DR   MD5; e0b2e3f4a83c86344e85f64a9aa3d03d.
DR   Ensembl-Gn; ENSG00000224608; homo_sapiens.
DR   Ensembl-Tr; ENST00000435618; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1093
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="Japanese HGN"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /haplotype="A3303 Cw0302 B5801 DRB1 1302"
FT                   /cell_type="lymphocyte"
FT                   /tissue_type="blood"
FT                   /note="genotype is A3303-Cw0302-B5801-DRB1
FT                   1302/A24-Cw1202-B52-DRB1 1502"
FT                   /db_xref="taxon:9606"
FT   CDS             1..1089
FT                   /codon_start=1
FT                   /product="HLA-B*5801"
FT                   /db_xref="GOA:P10319"
FT                   /db_xref="H-InvDB:HIT000058146.10"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*58:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10319"
FT                   /protein_id="BAA22916.1"
FT                   /translation="MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRI
FT                   ALRYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
XX
SQ   Sequence 1093 BP; 220 A; 335 C; 365 G; 173 T; 0 other;
     atgcgggtca cggcgccccg aaccgtcctc ctgctgctct ggggggcagt ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttctaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacccagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gaggacggag ccccgggcgc catggataga gcaggagggg       240
     ccggagtatt gggacgggga gacacggaac atgaaggcct ccgcgcagac ttaccgagag       300
     aacctgcgga tcgcgctccg ctactacaac cagagcgagg ccgggtctca catcatccag       360
     aggatgtatg gctgcgacct ggggcccgac gggcgcctcc tccgcgggca tgaccagtcc       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       480
     gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg       540
     agagcctacc tggagggcct gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gagacgctgc agcgcgcgga ccccccaaag acacacgtga cccaccaccc cgtctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atgggagcca       900
     tcttcccagt ccaccatccc catcgtgggc attgttgctg gcctggctgt cctagcagtt       960
     gtggtcatcg gagctgtggt cgctactgtg atgtgtagga ggaagagctc aggtggaaaa      1020
     ggagggagct actctcaggc tgcgtccagc gacagtgccc agggctctga tgtgtctctc      1080
     acagcttgaa aag                                                         1093
//


spacer
spacer