spacer

EBI Dbfetch

ID   AB003616; SV 2; linear; genomic DNA; STD; HUM; 1557 BP.
XX
AC   AB003616; AB003606;
XX
DT   23-NOV-1997 (Rel. 53, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MICB0105 gene for MICB, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1557
RA   Ando H.;
RT   ;
RL   Submitted (09-MAY-1997) to the INSDC.
RL   Hitoshi Ando, Japanese Red Cross, Kanagawa Shonan Blood Center, Section of
RL   Technology; 1837 Aiko, Atsugi, Kanagawa 243, Japan
RL   (Tel:0462-28-9800(ex.345), Fax:0462-28-0310)
XX
RN   [2]
RX   DOI; 10.1007/s002510050311.
RX   PUBMED; 9321430.
RA   Ando H., Mizuki N., Ota M., Yamazaki M., Ohno S., Goto K., Miyata Y.,
RA   Wakisaka K., Bahram S., Inoko H.;
RT   "Allelic variants of the human MHC class I chain-related B gene (MICB)";
RL   Immunogenetics 46(6):499-508(1997).
XX
DR   MD5; e404e1d0d32b9dc37268606ef58065a0.
DR   Ensembl-Gn; ENSG00000204516; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206449; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224378; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227772; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231179; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234218; homo_sapiens.
DR   Ensembl-Gn; ENSG00000238289; homo_sapiens.
DR   Ensembl-Tr; ENST00000427115; homo_sapiens.
DR   Ensembl-Tr; ENST00000428416; homo_sapiens.
DR   Ensembl-Tr; ENST00000443156; homo_sapiens.
DR   Ensembl-Tr; ENST00000546706; homo_sapiens.
DR   Ensembl-Tr; ENST00000547574; homo_sapiens.
DR   Ensembl-Tr; ENST00000549014; homo_sapiens.
DR   Ensembl-Tr; ENST00000551608; homo_sapiens.
DR   Ensembl-Tr; ENST00000551950; homo_sapiens.
DR   Ensembl-Tr; ENST00000551960; homo_sapiens.
DR   IMGT/LIGM; AB003616.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1557
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..42
FT                   /number=1
FT   CDS             join(<43..297,569..856,1021..1299,1399..>1530)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="MICB0105"
FT                   /product="MICB"
FT                   /db_xref="GOA:Q29980"
FT                   /db_xref="HGNC:HGNC:7091"
FT                   /db_xref="IMGT/HLA:MICB*003"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1JE6"
FT                   /db_xref="PDB:2WY3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29980"
FT                   /protein_id="BAA23483.1"
FT                   /translation="PHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQ
FT                   GQWAEDVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSSTR
FT                   GSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADC
FT                   LQKLQRYLKSGVAIRRTVPPMVNVICSEVSEGNITVTCRASSFYPRNITLTWRQDGVSL
FT                   SHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKALVLQS
FT                   QRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGP"
FT   exon            43..297
FT                   /gene="MICB0105"
FT                   /number=2
FT   intron          298..568
FT                   /number=2
FT   exon            569..856
FT                   /number=3
FT   intron          857..>874
FT                   /number=3
FT   gap             875..974
FT                   /estimated_length=unknown
FT   intron          <975..1020
FT                   /number=3
FT   exon            1021..1299
FT                   /number=4
FT   intron          1300..1398
FT                   /number=4
FT   exon            1399..1530
FT                   /number=5
FT   intron          1531..>1557
FT                   /number=5
XX
SQ   Sequence 1557 BP; 344 A; 362 C; 458 G; 293 T; 100 other;
     atttccagga agaagtttca cctgtgattt cctcttcccc agagccccac agtcttcgtt        60
     acaacctcat ggtgctgtcc caggatggat ctgtgcagtc agggtttctc gctgagggac       120
     atctggatgg tcagcccttc ctgcgctatg acaggcagaa acgcagggca aagccccagg       180
     gacagtgggc agaagatgtc ctgggagcta agacctggga cacagagacc gaggacttga       240
     cagagaatgg gcaagacctc aggaggaccc tgactcatat caaggaccag aaaggaggtg       300
     agagtcggca ggggcaagag taatgggagg ccttctccag gaaagttgga gacagagagc       360
     agggacctgt ctcttcccgc tggatctggc tgggggtggg gatgaggaat agggtcaggg       420
     aggctcagca gggtggtgag ccggaactca gcccacacag ggaggcatgg aggagggcca       480
     gggaggggtc gccgctgggc tgagttcctc acttgggtgg aaaggtgatg ggttcgggaa       540
     tggagaagtc actgctgggt gggggcaggc ttgcattccc tccaggagat tagggtctgt       600
     gagatccatg aagacagcag caccaggggc tcccggcatt tctactacga tggggagctc       660
     ttcctctccc aaaacctgga gactcaagaa tcgacagtgc cccagtcctc cagagctcag       720
     accttggcta tgaacgtcac aaatttctgg aaggaagatg ccatgaagac caagacacac       780
     tatcgcgcta tgcaggcaga ctgcctgcag aaactacagc gatatctgaa atccggggtg       840
     gccatcagga gaacaggtac cgaccctggc caggnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnncttaga ggggagcagg gcttcactgg ctctgccctt tcttctccag      1020
     tgccccccat ggtgaatgtc atctgcagcg aggtctcaga gggcaacatc accgtgacat      1080
     gcagggcttc cagcttctat ccccggaata tcacactgac ctggcgtcag gatggggtat      1140
     ctttgagcca caacacccag cagtgggggg atgtcctgcc tgatgggaat ggaacctacc      1200
     agacctgggt ggccaccagg attcgccaag gagaggagca gaggttcacc tgctacatgg      1260
     aacacagcgg gaatcacggc actcaccctg tgccctctgg tgagcctggg gtgaccctgg      1320
     agagggtcag gccagggtag gaacagcagg gacggctgtg gctctctgcc cagtgtataa      1380
     caagtccctt tttttcaggg aaggcgctgg tgcttcagag tcaacggaca gactttccat      1440
     atgtttctgc tgctatgcca tgttttgtta ttattattat tctctgtgtc ccttgttgca      1500
     agaagaaaac atcagcggca gagggtccag gtgagaaaag gggacagttt ctggaga         1557
//


spacer
spacer