spacer

EBI Dbfetch

ID   AB003614; SV 2; linear; genomic DNA; STD; HUM; 1599 BP.
XX
AC   AB003614; AB003604;
XX
DT   23-NOV-1997 (Rel. 53, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MICB0103103 gene for MICB, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1599
RA   Ando H.;
RT   ;
RL   Submitted (09-MAY-1997) to the INSDC.
RL   Hitoshi Ando, Japanese Red Cross, Kanagawa Shonan Blood Center, Section of
RL   Technology; 1837 Aiko, Atsugi, Kanagawa, 243, Japan
RL   (Tel:0462-28-9800(ex.345), Fax:0462-28-0310)
XX
RN   [2]
RX   DOI; 10.1007/s002510050311.
RX   PUBMED; 9321430.
RA   Ando H., Mizuki N., Ota M., Yamazaki M., Ohno S., Goto K., Miyata Y.,
RA   Wakisaka K., Bahram S., Inoko H.;
RT   "Allelic variants of the human MHC class I chain-related B gene (MICB)";
RL   Immunogenetics 46(6):499-508(1997).
XX
DR   MD5; fb36fe8c09209249eda7d6a99862c2e2.
DR   Ensembl-Gn; ENSG00000204516; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206449; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224378; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227772; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231179; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234218; homo_sapiens.
DR   Ensembl-Gn; ENSG00000238289; homo_sapiens.
DR   Ensembl-Tr; ENST00000427115; homo_sapiens.
DR   Ensembl-Tr; ENST00000428416; homo_sapiens.
DR   Ensembl-Tr; ENST00000443156; homo_sapiens.
DR   Ensembl-Tr; ENST00000546706; homo_sapiens.
DR   Ensembl-Tr; ENST00000547574; homo_sapiens.
DR   Ensembl-Tr; ENST00000549014; homo_sapiens.
DR   Ensembl-Tr; ENST00000551608; homo_sapiens.
DR   Ensembl-Tr; ENST00000551950; homo_sapiens.
DR   Ensembl-Tr; ENST00000551960; homo_sapiens.
DR   IMGT/LIGM; AB003614.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1599
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..83
FT                   /number=1
FT   CDS             join(<84..338,610..897,1063..1341,1441..>1572)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="MICB0103103"
FT                   /product="MICB"
FT                   /db_xref="GOA:Q29980"
FT                   /db_xref="HGNC:HGNC:7091"
FT                   /db_xref="IMGT/HLA:MICB*007"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1JE6"
FT                   /db_xref="PDB:2WY3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29980"
FT                   /protein_id="BAA23481.1"
FT                   /translation="PHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQ
FT                   GQWAEDVLGAETWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSSTR
FT                   GSRHFYYNGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADC
FT                   LQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSL
FT                   SHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQKFTCYMEHSGNHGTHPVPSGKALVLQS
FT                   QRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGP"
FT   exon            84..338
FT                   /gene="MICB103103"
FT                   /number=2
FT   intron          339..609
FT                   /number=2
FT   exon            610..897
FT                   /number=3
FT   intron          898..>916
FT                   /number=3
FT   gap             917..1016
FT                   /estimated_length=unknown
FT   intron          <1017..1062
FT                   /number=3
FT   exon            1063..1341
FT                   /number=4
FT   intron          1342..1440
FT                   /number=4
FT   exon            1441..1572
FT                   /number=5
FT   intron          1573..>1599
FT                   /number=5
XX
SQ   Sequence 1599 BP; 358 A; 370 C; 467 G; 303 T; 101 other;
     tcgggacagc agacctgtgt gttaaacatc aatgtgaagt tatttccagg aagaagtttc        60
     acctgtgatt tcctcttccc cagagcccca cagtcttcgt tacaacctca tggtgctgtc       120
     ccaggatgga tctgtgcagt cagggtttct cgctgaggga catctggatg gtcagccctt       180
     cctgcgctat gacaggcaga aacgcagggc aaagccccag ggacagtggg cagaagatgt       240
     cctgggagct gagacctggg acacagagac cgaggacttg acagagaatg ggcaagacct       300
     caggaggacc ctgactcata tcaaggacca gaaaggaggt gagagtcggc aggggcaaga       360
     gtaatgggag gccttctcca ggaaagttgg agacagagag cagggacctg tctcttcccg       420
     ctggatctgg ctgggggtgg ggatgaggaa tagggtcagg gaggctcagc agggtggtga       480
     gccggaactc agcccacaca gggaggcatg gaggagggcc agggaggggt cgccgctggg       540
     ctgagttcct cacttgggtg gaaaggtgat gggttcggga atggagaagt cactgctggg       600
     tgggggcagg cttgcattcc ctccaggaga ttagggtctg tgagatccat gaagacagca       660
     gcaccagggg ctcccggcat ttctactaca atggggagct cttcctctcc caaaacctgg       720
     agactcaaga atcgacagtg ccccagtcct ccagagctca gaccttggct atgaacgtca       780
     caaatttctg gaaggaagat gccatgaaga ccaagacaca ctatcgcgct atgcaggcag       840
     actgcctgca gaaactacag cgatatctga aatccggggt ggccatcagg agaacaggta       900
     ccgaccctgg ccagggnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnctta      1020
     gaggggagca ggncttcact ggctctgccc tttcttctcc agtgcccccc atggtgaatg      1080
     tcacctgcag cgaggtctca gagggcaaca tcaccgtgac atgcagggct tccagcttct      1140
     atccccggaa tatcacactg acctggcgtc aggatggggt atctttgagc cacaacaccc      1200
     agcagtgggg ggatgtcctg cctgatggga atggaaccta ccagacctgg gtggccacca      1260
     ggattcgcca aggagaggag cagaagttca cctgctacat ggaacacagc gggaatcacg      1320
     gcactcaccc tgtgccctct ggtgaacctg gggtgaccct ggagagggtc aggccagggt      1380
     aggaacagca gggacggctg tggctctctg cccagtgtat aacaagtccc tttttttcag      1440
     ggaaggcgct ggtgcttcag agtcaacgga cagactttcc atatgtttct gctgctatgc      1500
     catgttttgt tattattatt attctctgtg tcccttgttg caagaagaaa acatcagcgg      1560
     cagagggtcc aggtgagaaa aggggacagt ttctggaga                             1599
//


spacer
spacer