spacer

EBI Dbfetch

ID   AB003613; SV 2; linear; genomic DNA; STD; HUM; 1552 BP.
XX
AC   AB003613; AB003603;
XX
DT   23-NOV-1997 (Rel. 53, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MICB0103102 gene for MICB, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1552
RA   Ando H.;
RT   ;
RL   Submitted (09-MAY-1997) to the INSDC.
RL   Hitoshi Ando, Japanese Red Cross, Kanagawa Shonan Blood Center, Section of
RL   Technology; 1837 Aiko, Atsugi, Kanagawa 243, Japan
RL   (Tel:0462-28-9800(ex.345), Fax:0462-28-0310)
XX
RN   [2]
RX   DOI; 10.1007/s002510050311.
RX   PUBMED; 9321430.
RA   Ando H., Mizuki N., Ota M., Yamazaki M., Ohno S., Goto K., Miyata Y.,
RA   Wakisaka K., Bahram S., Inoko H.;
RT   "Allelic variants of the human MHC class I chain-related B gene (MICB)";
RL   Immunogenetics 46(6):499-508(1997).
XX
DR   MD5; 30cedf75819da845501d0d7f08610189.
DR   Ensembl-Gn; ENSG00000204516; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206449; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224378; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227772; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231179; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234218; homo_sapiens.
DR   Ensembl-Gn; ENSG00000238289; homo_sapiens.
DR   Ensembl-Tr; ENST00000427115; homo_sapiens.
DR   Ensembl-Tr; ENST00000428416; homo_sapiens.
DR   Ensembl-Tr; ENST00000443156; homo_sapiens.
DR   Ensembl-Tr; ENST00000546706; homo_sapiens.
DR   Ensembl-Tr; ENST00000547574; homo_sapiens.
DR   Ensembl-Tr; ENST00000549014; homo_sapiens.
DR   Ensembl-Tr; ENST00000551608; homo_sapiens.
DR   Ensembl-Tr; ENST00000551950; homo_sapiens.
DR   Ensembl-Tr; ENST00000551960; homo_sapiens.
DR   IMGT/LIGM; AB003613.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1552
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..35
FT                   /number=1
FT   CDS             join(<36..290,562..849,1016..1294,1394..>1525)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="MICB0103102"
FT                   /product="MICB"
FT                   /db_xref="GOA:Q29980"
FT                   /db_xref="HGNC:HGNC:7091"
FT                   /db_xref="IMGT/HLA:MICB*002:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1JE6"
FT                   /db_xref="PDB:2WY3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29980"
FT                   /protein_id="BAA23480.1"
FT                   /translation="PHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQ
FT                   GQWAEDVLGAETWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSSTR
FT                   GSRHFYYNGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADC
FT                   LQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSL
FT                   SHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKALVLQS
FT                   QRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGP"
FT   exon            36..290
FT                   /gene="MICB0103102"
FT                   /number=2
FT   intron          291..561
FT                   /number=2
FT   exon            562..849
FT                   /number=3
FT   intron          850..>869
FT                   /number=3
FT   gap             870..969
FT                   /estimated_length=unknown
FT   intron          <970..1015
FT                   /number=3
FT   exon            1016..1294
FT                   /number=4
FT   intron          1295..1393
FT                   /number=4
FT   exon            1394..1525
FT                   /number=5
FT   intron          1526..>1552
FT                   /number=5
XX
SQ   Sequence 1552 BP; 343 A; 361 C; 459 G; 289 T; 100 other;
     ggaagaagtt tcacctgtga tttcctcttc cccagagccc cacagtcttc gttacaacct        60
     catggtgctg tcccaggatg gatctgtgca gtcagggttt ctcgctgagg gacatctgga       120
     tggtcagccc ttcctgcgct atgacaggca gaaacgcagg gcaaagcccc agggacagtg       180
     ggcagaagat gtcctgggag ctgagacctg ggacacagag accgaggact tgacagagaa       240
     tgggcaagac ctcaggagga ccctgactca tatcaaggac cagaaaggag gtgagagtcg       300
     gcaggggcaa gagtaatggg aggccttctc caggaaagtt ggagacagag agcagggacc       360
     tgtctcttcc cactggatct ggctgggggt ggggatgagg aatagggtca gggaggctca       420
     gcagggtggt gagccggaac tcagcccaca cagggaggca tggaggaggg ccagggaggg       480
     gtcgccgctg ggctgagttc ctcacttggg tggaaaggtg atgggttcgg gaatggagaa       540
     gtcactgctg ggtgggggca ggcttgcatt ccctccagga gattagggtc tgtgagatcc       600
     atgaagacag cagcaccagg ggctcccggc atttctacta caatggggag ctcttcctct       660
     cccaaaacct ggagactcaa gaatcgacag tgccccagtc ctccagagct cagaccttgg       720
     ctatgaacgt cacaaatttc tggaaggaag atgccatgaa gaccaagaca cactatcgcg       780
     ctatgcaggc agactgcctg cagaaactac agcgatatct gaaatccggg gtggccatca       840
     ggagaacagg taccgaccct ggccaggggn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnc ttagagggga gcagggcttc actggctctg ccctttcttc tccagtgccc      1020
     cccatggtga atgtcacctg cagcgaggtc tcagagggca acatcaccgt gacatgcagg      1080
     gcttccagct tctatccccg gaatatcaca ctgacctggc gtcaggatgg ggtatctttg      1140
     agccacaaca cccagcagtg gggggatgtc ctgcctgatg ggaatggaac ctaccagacc      1200
     tgggtggcca ccaggattcg ccaaggagag gagcagaggt tcacctgcta catggaacac      1260
     agcgggaatc acggcactca ccctgtgccc tctggtgagc ctggggtgac cctggagagg      1320
     gtcaggccag ggtaggaaca gcagggacgg ctgtggctct ctgcccagtg tataacaagt      1380
     cccttttttt cagggaaggc gctggtgctt cagagtcaac ggacagactt tccatatgtt      1440
     tctgctgcta tgccatgttt tgttattatt attattctct gtgtcccttg ttgcaagaag      1500
     aaaacatcag cggcagaggg tccaggtgag aaaaggggac agtttctgga ga              1552
//


spacer
spacer