spacer

EBI Dbfetch

ID   AB003612; SV 2; linear; genomic DNA; STD; HUM; 1571 BP.
XX
AC   AB003612; AB003602;
XX
DT   23-NOV-1997 (Rel. 53, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MICB0103101 gene for MICB, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1571
RA   Ando H.;
RT   ;
RL   Submitted (09-MAY-1997) to the INSDC.
RL   Hitoshi Ando, Japanese Red Cross, Kanagawa Shonan Blood Center, Section of
RL   Technology; 1837 Aiko, Atsugi, Kanagawa 243, Japan
RL   (Tel:0462-28-9800(ex.345), Fax:0462-28-0310)
XX
RN   [2]
RX   DOI; 10.1007/s002510050311.
RX   PUBMED; 9321430.
RA   Ando H., Mizuki N., Ota M., Yamazaki M., Ohno S., Goto K., Miyata Y.,
RA   Wakisaka K., Bahram S., Inoko H.;
RT   "Allelic variants of the human MHC class I chain-related B gene (MICB)";
RL   Immunogenetics 46(6):499-508(1997).
XX
DR   MD5; 7ba716e87ac99ffc6658c7010a9e1743.
DR   Ensembl-Gn; ENSG00000204516; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206449; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224378; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227772; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231179; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234218; homo_sapiens.
DR   Ensembl-Gn; ENSG00000238289; homo_sapiens.
DR   Ensembl-Tr; ENST00000427115; homo_sapiens.
DR   Ensembl-Tr; ENST00000428416; homo_sapiens.
DR   Ensembl-Tr; ENST00000443156; homo_sapiens.
DR   Ensembl-Tr; ENST00000546706; homo_sapiens.
DR   Ensembl-Tr; ENST00000547574; homo_sapiens.
DR   Ensembl-Tr; ENST00000549014; homo_sapiens.
DR   Ensembl-Tr; ENST00000551608; homo_sapiens.
DR   Ensembl-Tr; ENST00000551950; homo_sapiens.
DR   Ensembl-Tr; ENST00000551960; homo_sapiens.
DR   IMGT/LIGM; AB003612.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1571
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..60
FT                   /number=1
FT   CDS             join(<61..315,587..874,1040..1318,1418..>1549)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="MICB0103101"
FT                   /product="MICB"
FT                   /db_xref="GOA:Q29980"
FT                   /db_xref="HGNC:HGNC:7091"
FT                   /db_xref="IMGT/HLA:MICB*002:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1JE6"
FT                   /db_xref="PDB:2WY3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29980"
FT                   /protein_id="BAA23479.1"
FT                   /translation="PHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQ
FT                   GQWAEDVLGAETWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSSTR
FT                   GSRHFYYNGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADC
FT                   LQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSL
FT                   SHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKALVLQS
FT                   QRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGP"
FT   exon            61..315
FT                   /gene="MICB0103101"
FT                   /number=2
FT   intron          316..586
FT                   /number=2
FT   exon            567..874
FT                   /number=3
FT   intron          875..>893
FT                   /number=3
FT   gap             894..993
FT                   /estimated_length=unknown
FT   intron          <994..1039
FT                   /number=3
FT   exon            1040..1318
FT                   /number=4
FT   intron          1319..1417
FT                   /number=4
FT   exon            1418..1549
FT                   /number=5
FT   intron          1550..>1571
FT                   /number=5
XX
SQ   Sequence 1571 BP; 350 A; 365 C; 459 G; 297 T; 100 other;
     aaacatcaat gtgaagttat ttccaggaag aagtttcacc tgtgatttcc tcttccccag        60
     agccccacag tcttcgttac aacctcatgg tgctgtccca ggatggatct gtgcagtcag       120
     ggtttctcgc tgagggacat ctggatggtc agcccttcct gcgctatgac aggcagaaac       180
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggagctgag acctgggaca       240
     cagagaccga ggacttgaca gagaatgggc aagacctcag gaggaccctg actcatatca       300
     aggaccagaa aggaggtgag agtcggcagg ggcaagagta atgggaggcc ttctccagga       360
     aagttggaga cagagagcag ggacctgtct cttcccgctg gatctggctg ggggtgggga       420
     tgaggaatag ggtcagggag gctcagcagg gtggtgagcc ggaactcagc ccacacaggg       480
     aggcatggag gagggccagg gaggggtcgc cgctgggctg agttcctcac ttgggtggaa       540
     aggtgatggg ttcgggaatg gagaagtcac tgctgggtgg gggcaggctt gcattccctc       600
     caggagatta gggtctgtga gatccatgaa gacagcagca ccaggggctc ccggcatttc       660
     tactacaatg gggagctctt cctctcccaa aacctggaga ctcaagaatc gacagtgccc       720
     cagtcctcca gagctcagac cttggctatg aacgtcacaa atttctggaa ggaagatgcc       780
     atgaagacca agacacacta tcgcgctatg caggcagact gcctgcagaa actacagcga       840
     tatctgaaat ccggggtggc catcaggaga acaggtaccg accctggcca gggnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnncttagag gggagcaggg cttcactggc      1020
     tctgcccttt cttctccagt gccccccatg gtgaatgtca cctgcagcga ggtctcagag      1080
     ggcaacatca ccgtgacatg cagggcttcc agcttctatc cccggaatat cacactgacc      1140
     tggcgtcagg atggggtatc tttgagccac aacacccagc agtgggggga tgtcctgcct      1200
     gatgggaatg gaacctacca gacctgggtg gccaccagga ttcgccaagg agaggagcag      1260
     aggttcacct gctacatgga acacagcggg aatcacggca ctcaccctgt gccctctggt      1320
     gagcctgggg tgaccctgga gagggtcagg ccagggtagg aacagcaggg acggctgtgg      1380
     ctctctgccc agtgtataac aagtcccttt ttttcaggga aggcgctggt gcttcagagt      1440
     caacggacag actttccata tgtttctgct gctatgccat gttttgttat tattattatt      1500
     ctctgtgtcc cttgttgcaa gaagaaaaca tcagcggcag agggtccagg tgagaaaagg      1560
     ggacagtttc t                                                           1571
//


spacer
spacer