spacer

EBI Dbfetch

ID   AB003611; SV 2; linear; genomic DNA; STD; HUM; 1583 BP.
XX
AC   AB003611; AB003601;
XX
DT   23-NOV-1997 (Rel. 53, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MICB01023 gene for MICB, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1583
RA   Ando H.;
RT   ;
RL   Submitted (09-MAY-1997) to the INSDC.
RL   Hitoshi Ando, Japanese Red Cross, Kanagawa Shonan Blood Center, Section of
RL   Technology; 1837 Aiko, Atsugi, Kanagawa 243, Japan
RL   (Tel:0462-28-9800(ex.345), Fax:0462-28-0310)
XX
RN   [2]
RX   DOI; 10.1007/s002510050311.
RX   PUBMED; 9321430.
RA   Ando H., Mizuki N., Ota M., Yamazaki M., Ohno S., Goto K., Miyata Y.,
RA   Wakisaka K., Bahram S., Inoko H.;
RT   "Allelic variants of the human MHC class I chain-related B gene (MICB)";
RL   Immunogenetics 46(6):499-508(1997).
XX
DR   MD5; c64afd5b766206c32d076d8dc1ef867a.
DR   Ensembl-Gn; ENSG00000204516; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206449; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224378; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227772; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231179; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234218; homo_sapiens.
DR   Ensembl-Gn; ENSG00000238289; homo_sapiens.
DR   Ensembl-Tr; ENST00000427115; homo_sapiens.
DR   Ensembl-Tr; ENST00000428416; homo_sapiens.
DR   Ensembl-Tr; ENST00000443156; homo_sapiens.
DR   Ensembl-Tr; ENST00000546706; homo_sapiens.
DR   Ensembl-Tr; ENST00000547574; homo_sapiens.
DR   Ensembl-Tr; ENST00000549014; homo_sapiens.
DR   Ensembl-Tr; ENST00000551608; homo_sapiens.
DR   Ensembl-Tr; ENST00000551950; homo_sapiens.
DR   Ensembl-Tr; ENST00000551960; homo_sapiens.
DR   IMGT/LIGM; AB003611.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1583
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..60
FT                   /number=1
FT   CDS             join(<61..315,587..874,1047..1325,1425..>1556)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="MICB01023"
FT                   /product="MICB"
FT                   /db_xref="GOA:Q29980"
FT                   /db_xref="HGNC:HGNC:7091"
FT                   /db_xref="IMGT/HLA:MICB*005:04"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1JE6"
FT                   /db_xref="PDB:2WY3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29980"
FT                   /protein_id="BAA23478.1"
FT                   /translation="PHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQ
FT                   GQWAEDVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSSTR
FT                   GSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADC
FT                   LQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSL
FT                   SHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKALVLQS
FT                   QRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGP"
FT   exon            61..315
FT                   /gene="MICB01023"
FT                   /number=2
FT   intron          316..586
FT                   /number=2
FT   exon            587..874
FT                   /number=3
FT   intron          875..>900
FT                   /number=3
FT   gap             901..1000
FT                   /estimated_length=unknown
FT   intron          <1001..1046
FT                   /number=3
FT   exon            1047..1325
FT                   /number=4
FT   intron          1326..1424
FT                   /number=4
FT   exon            1425..1556
FT                   /number=5
FT   intron          1557..>1583
FT                   /number=5
XX
SQ   Sequence 1583 BP; 353 A; 367 C; 464 G; 299 T; 100 other;
     aaacatcaat gtgaagttat ttccaggaag aagtttcacc tgtgatttcc tcttccccag        60
     agccccacag tcttcgttac aacctcatgg tgctgtccca ggatggatct gtgcagtcag       120
     ggtttctcgc tgagggacat ctggatggtc agcccttcct gcgctatgac aggcagaaac       180
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggagctaag acctgggaca       240
     cagagaccga ggacttgaca gagaatgggc aagacctcag gaggaccctg actcatatca       300
     aggaccagaa aggaggtgag agtcggcagg ggcaagagta atgggaggcc ttctccagga       360
     aagttggaga cagagagcag ggacctgtct cttcccgctg gatctggctg ggggtgggga       420
     tgaggaatag ggtcagggag gctcagcagg gtggtgagcc ggaactcagc ccacacaggg       480
     aggcatggag gagggccagg gaggggtcgc cgctgggctg agttcctcac ttgggtggaa       540
     aggtgatggg ttcgggaatg gagaagtcac tgctgggtgg gggcaggctt gcattccctc       600
     caggagatta gggtctgtga gatccatgaa gacagcagca ccaggggctc ccggcatttc       660
     tactacgatg gggagctctt cctctcccaa aacctggaga ctcaagaatc gacagtgccc       720
     cagtcctcca gagctcagac cttggctatg aacgtcacaa atttctggaa ggaagatgcc       780
     atgaagacca agacacacta tcgcgctatg caggcagact gcctgcagaa actacagcga       840
     tatctgaaat ccggggtggc catcaggaga acaggtaccg accctggcca ggggctctac       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn cttagagggg agcagggctt      1020
     cactggctct gccctttctt ctccagtgcc ccccatggtg aatgtcacct gcagcgaggt      1080
     ctcagagggc aacatcaccg tgacatgcag ggcttccagc ttctatcccc ggaatatcac      1140
     actgacctgg cgtcaggatg gggtatcttt gagccacaac acccagcagt ggggggatgt      1200
     cctgcctgat gggaatggaa cctaccagac gtgggtggcc accaggattc gccaaggaga      1260
     ggagcagagg ttcacctgct acatggaaca cagcgggaat cacggcactc accctgtgcc      1320
     ctctggtgag cctggggtga ccctggagag ggtcaggcca gggtaggaac agcagggacg      1380
     gctgtggctc tctgcccagt gtataacaag tccctttttt tcagggaagg cgctggtgct      1440
     tcagagtcaa cggacagact ttccatatgt ttctgctgct atgccatgtt ttgttattat      1500
     tattattctc tgtgtccctt gttgcaagaa gaaaacatca gcggcagagg gtccaggtga      1560
     gaaaagggga cagtttctgg aga                                              1583
//


spacer
spacer