spacer

EBI Dbfetch

ID   AB003610; SV 2; linear; genomic DNA; STD; HUM; 1575 BP.
XX
AC   AB003610; AB003600;
XX
DT   23-NOV-1997 (Rel. 53, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens MICB01022 gene for MICB, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1575
RA   Ando H.;
RT   ;
RL   Submitted (09-MAY-1997) to the INSDC.
RL   Hitoshi Ando, Japanese Red Cross, Kanagawa Shonan Blood Center, Section of
RL   Technology; 1837 Aiko, Atsugi, Kanagawa 243, Japan
RL   (Tel:0462-28-9800(ex.345), Fax:0462-28-0310)
XX
RN   [2]
RX   DOI; 10.1007/s002510050311.
RX   PUBMED; 9321430.
RA   Ando H., Mizuki N., Ota M., Yamazaki M., Ohno S., Goto K., Miyata Y.,
RA   Wakisaka K., Bahram S., Inoko H.;
RT   "Allelic variants of the human MHC class I chain-related B gene (MICB)";
RL   Immunogenetics 46(6):499-508(1997).
XX
DR   MD5; f036e531ff299723b5dbfe6b1b9a9850.
DR   Ensembl-Gn; ENSG00000204516; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206449; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224378; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227772; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231179; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234218; homo_sapiens.
DR   Ensembl-Gn; ENSG00000238289; homo_sapiens.
DR   Ensembl-Tr; ENST00000427115; homo_sapiens.
DR   Ensembl-Tr; ENST00000428416; homo_sapiens.
DR   Ensembl-Tr; ENST00000443156; homo_sapiens.
DR   Ensembl-Tr; ENST00000546706; homo_sapiens.
DR   Ensembl-Tr; ENST00000547574; homo_sapiens.
DR   Ensembl-Tr; ENST00000549014; homo_sapiens.
DR   Ensembl-Tr; ENST00000551608; homo_sapiens.
DR   Ensembl-Tr; ENST00000551950; homo_sapiens.
DR   Ensembl-Tr; ENST00000551960; homo_sapiens.
DR   IMGT/LIGM; AB003610.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1575
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..60
FT                   /number=1
FT   CDS             join(<61..315,587..874,1039..1317,1417..>1548)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="MICB01022"
FT                   /product="MICB"
FT                   /db_xref="GOA:Q29980"
FT                   /db_xref="HGNC:HGNC:7091"
FT                   /db_xref="IMGT/HLA:MICB*005:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1JE6"
FT                   /db_xref="PDB:2WY3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29980"
FT                   /protein_id="BAA23477.1"
FT                   /translation="PHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQ
FT                   GQWAEDVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSSTR
FT                   GSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADC
FT                   LQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSL
FT                   SHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKALVLQS
FT                   QRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGP"
FT   exon            61..315
FT                   /gene="MICB01022"
FT                   /number=2
FT   intron          316..586
FT                   /number=2
FT   exon            587..874
FT                   /number=3
FT   intron          875..>892
FT                   /number=3
FT   gap             893..992
FT                   /estimated_length=unknown
FT   intron          <993..1038
FT                   /number=3
FT   exon            1039..1317
FT                   /number=4
FT   intron          1318..1416
FT                   /number=4
FT   exon            1417..1548
FT                   /number=5
FT   intron          1549..>1575
FT                   /number=5
XX
SQ   Sequence 1575 BP; 353 A; 365 C; 460 G; 297 T; 100 other;
     aaacatcaat gtgaagttat ttccaggaag aagtttcacc tgtgatttcc tcttccccag        60
     agccccacag tcttcgttac aacctcatgg tgctgtccca ggatggatct gtgcagtcag       120
     ggtttctcgc tgagggacat ctggatggtc agcccttcct gcgctatgac aggcagaaac       180
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggagctaag acctgggaca       240
     cagagaccga ggacttgaca gagaatgggc aagacctcag gaggaccctg actcatatca       300
     aggaccagaa aggaggtgag agtcggcagg ggcaagagta atgggaggcc ttctccagga       360
     aagttggaga cagagagcag ggacctgtct cttcccgctg gatctggctg ggggtgggga       420
     tgaggaatag ggtcagggag gctcagcagg gtggtgagcc ggaactcagc ccacacaggg       480
     aggcatggag gagggccagg gaggggtcgc cgctgggctg agttcctcac ttgggtggaa       540
     aggtgatggg ttcgggaatg gagaagtcac tgctgggtgg gggcaggctt gcattccctc       600
     caggagatta gggtctgtga gatccatgaa gacagcagca ccaggggctc ccggcatttc       660
     tactacgatg gggagctctt cctctcccaa aacctggaga ctcaagaatc gacagtgccc       720
     cagtcctcca gagctcagac cttggctatg aacgtcacaa atttctggaa ggaagatgcc       780
     atgaagacca agacacacta tcgcgctatg caggcagact gcctgcagaa actacagcga       840
     tatctgaaat ccggggtggc catcaggaga acaggtaccg accctggcca ggnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nncttagagg ggagcagggc ttcactggct      1020
     ctgccctttc ttctccagtg ccccccatgg tgaatgtcac ctgcagcgag gtctcagagg      1080
     gcaacatcac cgtgacatgc agggcttcca gcttctatcc ccgaaatatc acactgacct      1140
     ggcgtcagga tggggtatct ttgagccaca acacccagca gtggggggat gtcctgcctg      1200
     atgggaatgg aacctaccag acctgggtgg ccaccaggat tcgccaagga gaggagcaga      1260
     ggttcacctg ctacatggaa cacagcggga atcacggcac tcaccctgtg ccctctggtg      1320
     agcctggggt gaccctggag agggtcaggc cagggtagga acagcaggga cggctgtggc      1380
     tctctgccca gtgtataaca agtccctttt tttcagggaa ggcgctggtg cttcagagtc      1440
     aacggacaga ctttccatat gtttctgctg ctatgccatg ttttgttatt attattattc      1500
     tctgtgtccc ttgttgcaag aagaaaacat cagcggcaga gggtccaggt gagaaaaggg      1560
     gacagtttct ggaga                                                       1575
//


spacer
spacer