spacer

EBI Dbfetch

ID   AB003609; SV 2; linear; genomic DNA; STD; HUM; 1573 BP.
XX
AC   AB003609; AB003599;
XX
DT   23-NOV-1997 (Rel. 53, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MICB01021 gene for MICB, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1573
RA   Ando H.;
RT   ;
RL   Submitted (09-MAY-1997) to the INSDC.
RL   Hitoshi Ando, Japanese Red Cross, Kanagawa Shonan Blood Center, Section of
RL   Technology; 1837 Aiko, Atsugi, Kanagawa 243, Japan
RL   (Tel:0462-28-9800(ex.345), Fax:0462-28-0310)
XX
RN   [2]
RX   DOI; 10.1007/s002510050311.
RX   PUBMED; 9321430.
RA   Ando H., Mizuki N., Ota M., Yamazaki M., Ohno S., Goto K., Miyata Y.,
RA   Wakisaka K., Bahram S., Inoko H.;
RT   "Allelic variants of the human MHC class I chain-related B gene (MICB)";
RL   Immunogenetics 46(6):499-508(1997).
XX
DR   MD5; 61922c9329842eed3bfaf74434f0803e.
DR   IMGT/LIGM; AB003609.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1573
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..60
FT                   /number=1
FT   CDS             join(<61..315,587..874,1037..1315,1415..>1546)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="MICB01021"
FT                   /product="MICB"
FT                   /db_xref="GOA:Q29980"
FT                   /db_xref="HGNC:HGNC:7091"
FT                   /db_xref="IMGT/HLA:MICB*005:02:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1JE6"
FT                   /db_xref="PDB:2WY3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29980"
FT                   /protein_id="BAA23476.1"
FT                   /translation="PHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQ
FT                   GQWAEDVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSSTR
FT                   GSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADC
FT                   LQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSL
FT                   SHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKALVLQS
FT                   QRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGP"
FT   exon            61..315
FT                   /gene="MICB01021"
FT                   /number=2
FT   intron          316..586
FT                   /number=2
FT   exon            587..874
FT                   /number=3
FT   intron          875..>890
FT                   /number=3
FT   gap             891..990
FT                   /estimated_length=unknown
FT   intron          <991..1036
FT                   /number=3
FT   exon            1037..1315
FT                   /number=4
FT   intron          1316..1414
FT                   /number=4
FT   exon            1415..1546
FT                   /number=5
FT   intron          1547..>1573
FT                   /number=5
XX
SQ   Sequence 1573 BP; 352 A; 365 C; 459 G; 297 T; 100 other;
     aaacatcaat gtgaagttat ttccaggaag aagtttcacc tgtgatttcc tcttccccag        60
     agccccacag tcttcgttac aacctcatgg tgctgtccca ggatggatct gtgcagtcag       120
     ggtttctcgc tgagggacat ctggatggtc agcccttcct gcgctatgac aggcagaaac       180
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggagctaag acctgggaca       240
     cagagaccga ggacttgaca gagaatgggc aagacctcag gaggaccctg actcatatca       300
     aggaccagaa aggaggtgag agtcggcagg ggcaagagta atgggaggcc ttctccagga       360
     aagttggaga cagagagcag ggacctgtct cttcccgctg gatctggctg ggggtgggga       420
     tgaggaatag ggtcagggag gctcagcagg gtggtgagcc ggaactcagc ccacacaggg       480
     aggcatggag gagggccagg gaggggtcgc cgctgggctg agttcctcac ttgggtggaa       540
     aggtgatggg ttcgggaatg gagaagtcac tgctgggtgg gggcaggctt gcattccctc       600
     caggagatta gggtctgtga gatccatgaa gacagcagca ccaggggctc ccggcatttc       660
     tactacgatg gggagctctt cctctcccaa aacctggaga ctcaagaatc gacagtgccc       720
     cagtcctcca gagctcagac cttggctatg aacgtcacaa atttctggaa ggaagatgcc       780
     atgaagacca agacacacta tcgcgctatg caggcagact gcctgcagaa actacagcga       840
     tatctgaaat ccggggtggc catcaggaga acaggtaccg accctggcca nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn cttagagggg agcagggctt cactggctct      1020
     gccctttctt ctccagtgcc ccccatggtg aatgtcacct gcagcgaggt ctcagagggc      1080
     aacatcaccg tgacatgcag ggcttccagc ttctatcccc ggaatatcac actgacctgg      1140
     cgtcaggatg gggtatcttt gagccacaac acccagcagt ggggggatgt cctgcctgat      1200
     gggaatggaa cctaccagac ctgggtggcc accaggattc gccaaggaga ggagcagagg      1260
     ttcacctgct acatggaaca cagcgggaat cacggcactc accctgtgcc ctctggtgag      1320
     cctggggtga ccctggagag ggtcaggcca gggtaggaac agcagggacg gctgtggctc      1380
     tctgcccagt gtataacaag tccctttttt tcagggaagg cgctggtgct tcagagtcaa      1440
     cggacagact ttccatatgt ttctgctgct atgccatgtt ttgttattat tattattctc      1500
     tgtgtccctt gttgcaagaa gaaaacatca gcggcagagg gtccaggtga gaaaagggga      1560
     cagtttctgg aga                                                         1573
//


spacer
spacer