spacer

EBI Dbfetch

ID   AB003618; SV 2; linear; genomic DNA; STD; HUM; 1596 BP.
XX
AC   AB003618; AB003608;
XX
DT   23-NOV-1997 (Rel. 53, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 7)
XX
DE   Homo sapiens MICB0107N gene for MICB, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1596
RA   Ando H.;
RT   ;
RL   Submitted (09-MAY-1997) to the INSDC.
RL   Hitoshi Ando, Japanese Red Cross, Kanagawa Shonan Blood Center, Section of
RL   Technology; 1837 Aiko, Atsugi, Kanagawa 243, Japan
RL   (Tel:0462-28-9800(ex.345), Fax:0462-28-0310)
XX
RN   [2]
RX   DOI; 10.1007/s002510050311.
RX   PUBMED; 9321430.
RA   Ando H., Mizuki N., Ota M., Yamazaki M., Ohno S., Goto K., Miyata Y.,
RA   Wakisaka K., Bahram S., Inoko H.;
RT   "Allelic variants of the human MHC class I chain-related B gene (MICB)";
RL   Immunogenetics 46(6):499-508(1997).
XX
DR   MD5; b69f0ee5ac09dde18fa185aa7f6ed4c9.
DR   IMGT/LIGM; AB003618.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1596
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..80
FT                   /number=1
FT   CDS             join(<81..335,607..858,1060..1338,1438..>1569)
FT                   /codon_start=3
FT                   /gene="MICB0107N"
FT                   /product="MICB"
FT                   /db_xref="IMGT/HLA:MICB*009N"
FT                   /protein_id="BAA23485.1"
FT                   /translation="PHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQ
FT                   GQWAEDVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSSTR
FT                   GSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADC
FT                   LQKLQLPPMVNVICSEVSEGNITVTCRASSFYPRNITLTWRQDGVSLSHNTQQWGDVLP
FT                   DGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKALVLQSQRTDFPYVSAAM
FT                   PCFVIIIILCVPCCKKKTSAAEGP"
FT   exon            81..335
FT                   /gene="MICB0107N"
FT                   /number=2
FT   intron          336..606
FT                   /number=2
FT   exon            607..858
FT                   /number=3
FT   intron          857..>913
FT                   /number=3
FT   gap             914..1013
FT                   /estimated_length=unknown
FT   intron          <1014..1059
FT                   /number=3
FT   exon            1060..1338
FT                   /number=4
FT   intron          1339..1437
FT                   /number=4
FT   exon            1438..1569
FT                   /number=5
FT   intron          1570..>1596
FT                   /number=5
XX
SQ   Sequence 1596 BP; 356 A; 367 C; 469 G; 304 T; 100 other;
     ggacagcaga cctgtgtgtt aaacatcaat gtgaagttat ttccaggaag aagtttcacc        60
     tgtgatttcc tcttccccag agccccacag tcttcgttac aacctcatgg tgctgtccca       120
     ggatggatct gtgcagtcag ggtttctcgc tgagggacat ctggatggtc agcccttcct       180
     gcgctatgac aggcagaaac gcagggcaaa gccccaggga cagtgggcag aagatgtcct       240
     gggagctaag acctgggaca cagagaccga ggacttgaca gagaatgggc aagacctcag       300
     gaggaccctg actcatatca aggaccagaa aggaggtgag agtcggcagg ggcaagagta       360
     atgggaggcc ttctccagga aagttggaga cagagagcag ggacctgtct cttcccgctg       420
     gatctggctg ggggtgggga tgaggaatag ggtcagggag gctcagcagg gtggtgagcc       480
     ggaactcagc ccacacaggg aggcatggag gagggccagg gaggggtcgc cgctgggctg       540
     agttcctcac ttgggtggaa aggtgatggg ttcgggaatg gagaagtcac tgctgggtgg       600
     gggcaggctt gcattccctc caggagatta gggtctgtga gatccatgaa gacagcagca       660
     ccaggggctc ccggcatttc tactacgatg gggagctctt cctctcccaa aacctggaga       720
     ctcaagaatc gacagtgccc cagtcctcca gagctcagac cttggctatg aacgtcacaa       780
     atttctggaa ggaagatgcc atgaagacca agacacacta tcgcgctatg caggcagact       840
     gcctgcagaa actacagtga tatctgaaat ccggggtggc catcaggaga acaggtaccg       900
     accctggcca gggnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnncttagag      1020
     gggagcaggg cttcactggc tctgcccttt cttctccagt gccccccatg gtgaatgtca      1080
     tctgcagcga ggtctcagag ggcaacatca ccgtgacatg cagggcttcc agcttctatc      1140
     cccggaatat cacactgacc tggcgtcagg atggggtatc tttgagccac aacacccagc      1200
     agtgggggga tgtcctgcct gatgggaatg gaacctacca gacctgggtg gccaccagga      1260
     ttcgccaagg agaggagcag aggttcacct gctacatgga acacagcggg aatcacggca      1320
     ctcaccctgt gccctctggt gagcctgggg tgaccctgga gagggtcagg ccagggtagg      1380
     aacagcaggg acggctgtgg ctctctgccc agtgtataac aagtcccttt ttttcaggga      1440
     aggcgctggt gcttcagagt caacggacag actttccata tgtttctgct gctatgccat      1500
     gttttgttat tattattatt ctctgtgtcc cttgttgcaa gaagaaaaca tcagcggcag      1560
     agggtccagg tgagaaaagg ggacagtttc tggaga                                1596
//


spacer
spacer