spacer

EBI Dbfetch

ID   AB003615; SV 2; linear; genomic DNA; STD; HUM; 1600 BP.
XX
AC   AB003615; AB003605;
XX
DT   23-NOV-1997 (Rel. 53, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Homo sapiens MICB0104 gene for MICB, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1600
RA   Ando H.;
RT   ;
RL   Submitted (09-MAY-1997) to the INSDC.
RL   Hitoshi Ando, Japanese Red Cross, Kanagawa Shonan Blood Center, Section of
RL   Technology; 1837 Aiko, Atsugi, Kanagawa 243, Japan
RL   (Tel:0462-28-9800(ex.345), Fax:0462-28-0310)
XX
RN   [2]
RX   DOI; 10.1007/s002510050311.
RX   PUBMED; 9321430.
RA   Ando H., Mizuki N., Ota M., Yamazaki M., Ohno S., Goto K., Miyata Y.,
RA   Wakisaka K., Bahram S., Inoko H.;
RT   "Allelic variants of the human MHC class I chain-related B gene (MICB)";
RL   Immunogenetics 46(6):499-508(1997).
XX
DR   Ensembl-Gn; ENSG00000204516; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206449; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224378; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227772; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231179; homo_sapiens.
DR   Ensembl-Gn; ENSG00000234218; homo_sapiens.
DR   Ensembl-Gn; ENSG00000238289; homo_sapiens.
DR   Ensembl-Tr; ENST00000252229; homo_sapiens.
DR   Ensembl-Tr; ENST00000383514; homo_sapiens.
DR   Ensembl-Tr; ENST00000427115; homo_sapiens.
DR   Ensembl-Tr; ENST00000428416; homo_sapiens.
DR   Ensembl-Tr; ENST00000443156; homo_sapiens.
DR   Ensembl-Tr; ENST00000451603; homo_sapiens.
DR   Ensembl-Tr; ENST00000546706; homo_sapiens.
DR   Ensembl-Tr; ENST00000547574; homo_sapiens.
DR   Ensembl-Tr; ENST00000549014; homo_sapiens.
DR   Ensembl-Tr; ENST00000551608; homo_sapiens.
DR   Ensembl-Tr; ENST00000551950; homo_sapiens.
DR   Ensembl-Tr; ENST00000551960; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1600
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   intron          <1..85
FT                   /number=1
FT   CDS             join(<86..340,612..899,1064..1342,1442..>1573)
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="MICB0104"
FT                   /product="MICB"
FT                   /db_xref="GOA:Q29980"
FT                   /db_xref="HGNC:HGNC:7091"
FT                   /db_xref="IMGT/HLA:MICB*004:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="PDB:1JE6"
FT                   /db_xref="PDB:2WY3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29980"
FT                   /protein_id="BAA23482.1"
FT                   /translation="PHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQ
FT                   GQWAENVLGAKTWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVCEIHEDSSTR
FT                   GSRHFYYDGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADC
FT                   LQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSL
FT                   SHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKALVLQS
FT                   QRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGP"
FT   exon            86..340
FT                   /gene="MICB0104"
FT                   /number=2
FT   intron          341..611
FT                   /number=2
FT   exon            612..899
FT                   /number=3
FT   intron          900..>917
FT                   /number=3
FT   gap             918..1017
FT                   /estimated_length=unknown
FT   intron          <1018..1063
FT                   /number=3
FT   exon            1064..1342
FT                   /number=4
FT   intron          1343..1441
FT                   /number=4
FT   exon            1442..1573
FT                   /number=5
FT   intron          1574..>1600
FT                   /number=5
XX
SQ   Sequence 1600 BP; 357 A; 369 C; 470 G; 304 T; 100 other;
     ggtcgggaca gcagacctgt gtgttaaaca tcaatgtgaa gttatttcca ggaagaagtt        60
     tcacctgtga tttcctcttc cccagagccc cacagtcttc gttacaacct catggtgctg       120
     tcccaggatg gatctgtgca gtcagggttt ctcgctgagg gacatctgga tggtcagccc       180
     ttcctgcgct atgacaggca gaaacgcagg gcaaagcccc agggacagtg ggcagaaaat       240
     gtcctgggag ctaagacctg ggacacagag accgaggact tgacagagaa tgggcaagac       300
     ctcaggagga ccctgactca tatcaaggac cagaaaggag gtgagagtcg gcaggggcaa       360
     gagtaatggg aggccttctc caggaaagtt ggagacagag agcagggacc tgtctcttcc       420
     cgctggatct ggctgggggt ggggatgagg aatagggtca gggaggctca gcagggtggt       480
     gagccggaac tcagcccaca cagggaggca tggaggaggg ccagggaggg gtcgctgctg       540
     ggctgagttc ctcacttggg tggaaaggtg atgggttcgg gaatggagaa gtcactgctg       600
     ggtgggggca ggcttgcatt ccctccagga gattagggtc tgtgagatcc atgaagacag       660
     cagcaccagg ggctcccggc atttctacta cgatggggag ctcttcctct cccaaaacct       720
     ggagactcaa gaatcgacag tgccccagtc ctccagagct cagaccttgg ctatgaacgt       780
     cacaaatttc tggaaggaag atgccatgaa gaccaagaca cactatcgcg ctatgcaggc       840
     agactgcctg cagaaactac agcgatatct gaaatccggg gtggccatca ggagaacagg       900
     taccgaccct ggccaggnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnctt      1020
     agaggggagc agggcttcac tggctctgcc ctttcttctc cagtgccccc catggtgaat      1080
     gtcacctgca gcgaggtctc agagggcaac atcaccgtga catgcagggc ttccagcttc      1140
     tatccccgga atatcacact gacctggcgt caggatgggg tatctttgag ccacaacacc      1200
     cagcagtggg gggatgtcct gcctgatggg aatggaacct accagacctg ggtggccacc      1260
     aggattcgcc aaggagagga gcagaggttc acctgctaca tggaacacag cgggaatcac      1320
     ggcactcacc ctgtgccctc tggtgagcct ggggtgaccc tggagagggt caggccaggg      1380
     taggaacagc agggacggct gtggctctct gcccagtgta taacaagtcc ctttttttca      1440
     gggaaggcgc tggtgcttca gagtcaacgg acagactttc catatgtttc tgctgctatg      1500
     ccatgttttg ttattattat tattctctgt gtcccttgtt gcaagaagaa aacatcagcg      1560
     gcagagggtc caggtgagaa aaggggacag tttctggaga                            1600
//


spacer
spacer