spacer

EBI Dbfetch

ID   AB002468; SV 1; linear; genomic DNA; STD; HUM; 221 BP.
XX
AC   AB002468;
XX
DT   10-APR-1997 (Rel. 51, Created)
DT   10-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Homo sapiens HLA-DQB1 gene for MHC class II HLA-DQ beta-1, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-221
RA   Onishi H.;
RT   ;
RL   Submitted (04-APR-1997) to the INSDC.
RL   Contact:Hiroshi Onishi Sumitomo Metal Industries, LTD. Diagnostics section,
RL   Medical Business dept.; 16-1 Sunayama, Hasaki-cho, Kashima-gun, Ibaraki
RL   314-02, Japan
XX
RN   [2]
RA   Onishi H., Koshizaka T., Yashiki S., Hayami M., Sonoda S.;
RT   "A new HLA-DQB1 allele, DQB1*GHA30 (DQB1*0203)";
RL   Unpublished.
XX
DR   MD5; 2ef3ec3938f4b013b64b208cc72fdaca.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..221
FT                   /organism="Homo sapiens"
FT                   /isolate="GHA-30"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /note="Ghanaian"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>221
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II HLA-DQ beta-1"
FT                   /note="exon2"
FT                   /db_xref="GOA:O19632"
FT                   /db_xref="IMGT/HLA:DQB1*02:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O19632"
FT                   /protein_id="BAA19528.1"
FT                   /translation="YQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTLL
FT                   GLPDAEYWNSQKDILERKRAAVDRVCRH"
XX
SQ   Sequence 221 BP; 51 A; 52 C; 81 G; 37 T; 0 other;
     tgtaccagtt taagggcatg tgctacttca ccaacgggac agagcgcgtg cgtcttgtga        60
     gcagaagcat ctataaccga gaagagatcg tgcgcttcga cagcgacgtg ggggagttcc       120
     gggcggtgac gctgctgggg ctgcctgacg ccgagtactg gaacagccag aaggacatcc       180
     tggagaggaa acgggcggcg gtggacaggg tgtgcagaca c                           221
//


spacer
spacer