spacer

EBI Dbfetch

>sp|P01174|WAP_RAT Whey acidic protein OS=Rattus norvegicus GN=Wap PE=1 SV=2
MRCSISLVLGLLALEVALARNLQEHVFNSVQSMCSDDSFSEDTECINCQTNEECAQNDMC
CPSSCGRSCKTPVNIEVQKAGRCPWNPIQMIAAGPCPKDNPCSIDSDCSGTMKCCKNGCI
MSCMDPEPKSPTVISFQ


spacer
spacer