Dbfetch

ID   KIR00186; SV 2; standard; DNA; HUM; 12424 BP.
XX
AC   KIR00186;
XX
SV   KIR00186.2
XX
DT   30-JAN-2006 (Rel. 1.3.0, Created, Version 1)
DT   04-JUN-2007 (Rel. 1.4.0, Sequence Updated, Version 2)
DT   14/02/2018 (Rel. 2.7.1, Current Release, Version 2)
XX
DE   KIR3DL3*0140201, Human Killer-cell Immunoglobulin-like Receptor
XX
KW   Human Killer-cell Immunoglobulin-like Receptor; KIR3DL3*0140201;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IPD-KIR Release Version 2.7.1
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IPD Database, Distributed under the Creative Commons
CC   Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/ipd/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
RN   [1]
RP   1-12424
RX   PUBMED; 16823588.
RA   Jones DC, Hiby SE, Moffett A, Trowsdale J, Young NT;
RT   "Nature of allelic sequence polymorphism at the KIR3DL3 locus";
RL   Immunogenetics 58:614-27(2006).
XX
RN   [2]
RP   1-12424
RX   PUBMED; 17900289.
RA   Hou L, Chen M, Steiner NK, Belle I, Turino C, Ng J, Hurley CK;
RT   "Seventeen novel alleles add to the already extensive KIR3DL3 diversity";
RL   Tissue Antigens 70:449-54(2007).
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence as approved by the
CC   KIR Nomenclature Committee.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; DQ288866; DQ288866.0.
DR   EMBL; DQ288871; DQ288871.0.
DR   EMBL; DQ315408; DQ315408.0.
DR   EMBL; DQ315411; DQ315411.0.
DR   EMBL; DQ315413; DQ315413.0.
DR   EMBL; DQ315416; DQ315416.0.
DR   EMBL; DQ471908; DQ471908.0.
DR   EMBL; GU182349; GU182349.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..12424
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Caucasoid"
FT                   /cell_line="BHF649"
FT                   /cell_line="G085"
FT                   /cell_line="GU1098"
FT   CDS             join(263..296,1013..1048,1819..2103,3377..3676,5259..5552,
FT                   11020..11124,11587..11639,11738..11863)
FT                   /codon_start=1
FT                   /gene="KIR3DL3"
FT                   /allele="KIR3DL3*0140201"
FT                   /product="KIR3DL3 Killer-cell Immunoglobulin-like Receptor"
FT                   /translation="MSLMVVSMACVGFFLLEGPWPHVGGQDKPFLSAWPGTVVSEGQHV
FT                   TLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPT
FT                   GWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITED
FT                   PLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYG
FT                   KPSLSAQPGPTVQAGENVTLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFP
FT                   LGPVTHGGNYRCFGSFRALPHAWSDPSDPLPVSVTGNSRYLHALIGTSVVIIPFAILLF
FT                   FLLHRWCANKKNAVVMDQEPAGNRTVNREDSDEQDPQEVTYAQLNHCVFTQRKITRPSQ
FT                   RPKTPPTDTSV"
FT   UTR             1..262
FT   exon            263..296
FT                   /number="1"
FT   intron          297..1012
FT                   /number="1"
FT   exon            1013..1048
FT                   /number="2"
FT   intron          1049..1818
FT                   /number="2"
FT   exon            1819..2103
FT                   /number="3"
FT   intron          2104..3376
FT                   /number="3"
FT   exon            3377..3676
FT                   /number="4"
FT   intron          3677..5258
FT                   /number="4"
FT   exon            5259..5552
FT                   /number="5"
FT   intron          5553..11019
FT                   /number="5/6"
FT   exon            11020..11124
FT                   /number="7"
FT   intron          11125..11586
FT                   /number="7"
FT   exon            11587..11639
FT                   /number="8"
FT   intron          11640..11737
FT                   /number="8"
FT   exon            11738..11863
FT                   /number="9"
FT   UTR             11864..12424
SQ   Sequence 12424 BP; 3341 A; 2854 C; 3215 G; 3014 T; 0 other;
     gtatgagaga ttggatctga gacgtgtttt gagttggtta tagtgaagga tgcaaggtgt        60
     caattctagt tggaacaatt tccaggaagc catgttccgc tcttgaccaa acagccactg       120
     ggcctcatgc aaggtagaaa tagcctgcat acgtcatcct cccatgatgt ggtcagcatg       180
     taaactgcat gagcccctca caacatcctg tgtgctgctg aactgagctg gggcgcagcc       240
     gcctgtctgc accggcagca ccatgtcgct catggtcgtc agcatggcgt gtgttggtga       300
     gtcctggaag ggaatcgagg gagggagcgc tggggtggag atctgggcct ggagtggaga       360
     tctgggcctg gagtggagat atgggcctgg agtggagata taggcctgga gtggagatat       420
     gggcctgggg tggagatatg ggcctggagt ggagatatgg gcctggaact gtagatatgg       480
     gcctgaagta gagatatggg cctggagtag agatatgggc ctggaactgt agatatgggc       540
     ctggagtgga gatattggct tggagtgcag atatggacct ggaattgaga tacgggcctg       600
     gaggtggaga tatgggccta gagtggagat atgggcctgg aggtggagat atgggcctgg       660
     aactgtagat atgggcctgg agtagagata cgggcctgga gtggagatgt tggcttggag       720
     tgcagatatg ggcctggaat ggagacacgg gcctggaggt ggagatacag gcctggaggt       780
     ggagatatgg gcctggagtg tagatatggg cctggagtag agatatagga cggaggtgga       840
     gatataggcc tggagtggag atatgggcct ggagtagaga tataggacgg aggtggagat       900
     ataggcctgg agtggagata tgggcctaga ggtggagata tgggcctgga gtggagatat       960
     gggcctggag gtgatgtaca gatggatcat ccatcatgat ctttctttcc agggttcttc      1020
     ttgctggagg ggccctggcc acatgtgggt gagtccttcc cccaaacctt aggttgtcat      1080
     ctccccacat aagatgatgc tcctgaaacg ggaggcaggc gacacagggg gttgactgat      1140
     gggctgacca tgggaagcca tgtgggaatc tctcatgaac taggaaaagg aagccagggg      1200
     aagcttcgcc acagttctgt cctagccctc cccggccttt ctttcccttg gctgagtctg      1260
     tggggaccca gggggagact gaagtgctca aaggagtggt gtgcagggag gaagtggtgt      1320
     caccggcaga ggaagggaga gaagcagtgc aaggaacaac aggcctctga ggacaagagc      1380
     ataactcaca ccctccagcg tttccatgac ggtaggggct gcaatgtggc tgctgtcatt      1440
     ctacctaaga ggtgggggaa ccacagtcat gaccctgaca ttccagatct tctaataggg      1500
     gctcagttgt ttattatggt tcatgcatta gctgatcatg ccctccatcc tgtgtctacc      1560
     ttgtgttctt ttatgtaagt aattttgcag tgttaaaatc tagtaagagt cgcttcttca      1620
     gcacctgctc aaagttctca gctgacactt gctgtaggga gacgccatgt ctatgcggga      1680
     tgggtccttc ctgtagccct gggcacccag gtgtggtagg agccttagaa acgtggaaat      1740
     gggagaatct tctgagcaca gggagggagg ggcggctcca catcctcctc tctaaggtgg      1800
     tgcctccttc tcccccaggt ggtcaggaca agcccttcct ctctgcctgg cccggcactg      1860
     tggtgtctga aggacaacat gtgactcttc agtgtcgctc tcgtcttggg tttaatgaat      1920
     tcagtctgtc caaagaagac gggatgcctg tccctgagct ctacaacaga atattccgga      1980
     acagctttct catgggccct gtgaccccag cacatgcagg gacctacaga tgttgcagtt      2040
     cacacccaca ctcccccact gggtggtcgg cacccagcaa ccctgtggtg atcatggtca      2100
     caggtcagag gctttctgtc tgggcttctc actgtcccac ctcctgaatc ccagagcttc      2160
     tggtgggggc gtccatcagg gtccaatcat ccaggccccg actgtatttg gggtaaaggg      2220
     ggattcagta cagagaaata gttgctgtgg tgggaagaat aattgtcccc agtgatggct      2280
     acatggtaat ccatgaaccc tgtgactatt tatgttatag ggcaggggac tgaagaggaa      2340
     gatggagctc aggttgttga tgagttgacc ttgcgatggg gagacagcct ggactgtcct      2400
     gctgtgctca gagtaatcac aagggtcctc atgagaggag gaggaagagg aaagtggggt      2460
     tagagcaacg tcgtgggagg gagactccat cagccacagc gggctttgaa gatgggggaa      2520
     ggccatgagc cacaaaggca ggtggcctct aagggctgga gaagtcaagg gaactgattc      2580
     ttccctgagt ctccagagga aacacagccc tgcagatgcc ttgattttag cccagagaga      2640
     actgggtccg atttctgttc tccagaagtg gaaggggtca ttgtattctc tcctgcccca      2700
     tgtttgtgac aattttctcc agcagcaaca ggaaaccaac acaggaaccc aggtgaagca      2760
     caggttaaga aaccaaacaa ggagaaggtt ggctacactg attttagcat gggtgggata      2820
     ctgatgctac caccaggctc gatccacata gggaggggtt gatgctcctg gaaccagcac      2880
     caggggccac cctatggaag ctggggccat ggagaaggca cagacatgaa aggagaggct      2940
     cccaatcccc atcaggaaca gggacactga tgcctgcctt actgatgagt tcgtacctcc      3000
     tgccggcctt tccaatctgt ccaaaagaga ttgattcagg ctgctaagag cctggacatg      3060
     cagcctgtca tggttcctct tccaccccca cataaacacc aggaaagaga ttagtgggaa      3120
     acagatacaa cagcctaaga ggtgacactg agcacagtgg gaagggaatc agggctacta      3180
     gagacagaga gacagggaag agggagggag acagatggag ggacctgcaa caggggttat      3240
     gggcacaaaa gaacacggag acacagacag gaaggagaca gatagacacc atggagggga      3300
     agcctcactt atttcaggtc ccatgaatgg gatgagaaag ggagacgcct tctgaactca      3360
     caacctctct tcttaggagt ccacagaaaa ccttccctcc tggcccaccc aggtcccctg      3420
     gtgaaatcag gagagacggt catcctgcaa tgttggtcag atgtcaggtt tgagcgcttc      3480
     cttctgcaca gagaggggat cactgaggac cccttgcgcc tcgttggaca gctccacgat      3540
     gcgggttccc aggtcaacta ttccatgggt cccatgacac ctgcccttgc agggacctac      3600
     agatgctttg gttctgtcac tcacttaccc tatgagttgt cggctcccag tgaccctctg      3660
     gacatcgtgg tcgtaggtga gagaatacag acctgcctct cacccttgct gggagatgga      3720
     gtgaatgatc taggactgga agccccaggt ggtcatgagg aagatgagtg tggggttcct      3780
     atggagagaa agtgacttgg tgaggtctgt accaacaaag gcagagaaac aggagacaca      3840
     agtacagacc tcatgtcata acatagaagc cagacacagg ggccatacaa ggtgttagaa      3900
     aaagagataa agaggtaaag aagacacaga gagacagaca tatcccagag agaggtgtcc      3960
     ttctatgctg actttgttca gagaccaggc acaggttaga aggttccatt ctgttttacc      4020
     tctacaaagt gttctctccc aggagaaccc aaagagacac atctatctgg cctgagttgg      4080
     gccatgtggc cccaggctgg tggcacctac agatgttgtg tttattctta aacctctgcc      4140
     ttccgtgcag tggagctgtc atcgtcccag gacaccatgg ccccaggtga gggagcagaa      4200
     caccaacccc tgtatgctgt gagttcctgg agtccccata ctggattctg aggctcatat      4260
     tcaaatagca ccacatgtta taggattact gagaacaaaa gcccacagag agacacggag      4320
     tgaaatcagg gaaatcaaaa agcaaagaca tgaacacaca cacagaatga gccagaagaa      4380
     gggaattgag agactcacag acacataaag agatagaaaa agagggcaga gaagtggagc      4440
     gtatgatgga aggaagcaga gaaaagccct aaaatcagag ccctgaggga ggggcacaaa      4500
     gacagggaaa gataaagatg tgaggatgga ttgcagagac tccaaaaggg aactagagag      4560
     actgagaggc agagaaagac aaggagatgg agagagacag atgatagatg gacagataga      4620
     tatagataga tgaaagataa aaggtagatg atagataata gagagacagg tgatagacaa      4680
     atagatgatg aatgactgat agatgatata gatagacaag tagaaagaca gacagatgat      4740
     atataaatag atatagagag atagaaagac agataaacac atgatgatag atggatagat      4800
     gcatacatac atacattgat tgatagatga tagataacag agagataggt catagataca      4860
     cagatgatga tagatgatag atacatacat agataaatga tagatcgatc aatagataat      4920
     agatagaaat atgcagaaag ttatgagcaa gacagaaagt gagagactca gaattaaaga      4980
     aagaggaaga tcaagtcaac cagtccaagg agggtcagag agaataaaat ggtacaaaaa      5040
     aagaaaacat agctagggat ggagaagtga ggtcagagac ctagagagac agagaaggtg      5100
     gaaggaggaa atagacatga agagagatgg gggtggaggg tgagagagag aaagagagca      5160
     ttaagtcata gagcagggga gtgagttctc agctcaggtg tgaggagagc tgtgacaagg      5220
     aagaacctcc ctgaggaaac cacctcttct tcttccaggt ctatatggga aaccttctct      5280
     ctcagcccag ccgggcccca cggttcaggc aggagagaat gtgaccttgt cctgcagctc      5340
     ccggagcttg tttgacattt accatctatc cagggaggcg gaggccggtg aacttaggct      5400
     cactgcagtg ctgagggtca atggaacatt ccaggccaac ttccctctgg gccctgtgac      5460
     ccacggaggg aactacagat gcttcggctc tttccgtgcc ctgccccatg cgtggtcaga      5520
     cccgagtgac ccactgcccg tttctgtcac aggtgagaaa acaccatgcc tgtcccatgt      5580
     cttgtgatcc tagagccata gctgaggagc ttcctgctga tgatggagag aagcatggac      5640
     agatgccgag acagaacaca cagcatgggt gtaagggcgg ggtcagggcg caggatggca      5700
     gacagggcac ctccaaaccc tcctgtatgg cctgcaagga tgcccttgat cagggttcca      5760
     ggcacccagg cagatggaga aagaggtcag aacagaccca gaggagggag actgggctct      5820
     gcctggggag atcagaggtt ctctcagccc ctcaacctta cccacttccc agaagcccat      5880
     cctggcctgt cacccacaga gagatgtcat caccagcaac gcctacaccc ttttcttttt      5940
     gtttgaagaa atatttattg aggtgaaata tacctatgta atttaccacc tttaccattt      6000
     ttaagtgtga agtctactgt tcataaatac atttataggc tgggcacggt ggctcacggt      6060
     tgtaatccca acactttgag aggccaaggc aggtggatca tttgagatca ggggctcaag      6120
     accaccctgg ccaacatggg gaaaatccat ctgtactaaa aatacaaaat aataattata      6180
     atgataataa ttagccgagc atggtggcac atgcctgtag tcccagctac ttggtagggt      6240
     tgggcaggag ttgcacttaa ttgcaggagg cggaggttgc agtgagctga gatcatgcca      6300
     ctgcactgca gcctgggcaa cagagagaga cactctctca aaattaatta attaattaat      6360
     tagtattctt ttttttttac cctccaccct tcccttcctg gcctctggta gccaccattc      6420
     tactctctac ctttgtgaga tccacctttt agctcctgca tatgagtgag aaatggaaat      6480
     acttgtaatg acctccagtt ccattcatgt ggctgtaaat gacaggatgt tactctttct      6540
     atggatgagt tgtccctatt gtgtgtgtgt accacattct ctccatccat tcacccactg      6600
     atgggcaggt aggttgatcc acatcttggc tactgtgaac actgctggaa cagtcatggg      6660
     agtgcagatg tcacttcgat acgctgatgt cctttccttt gggtttacac ccagtcatgg      6720
     aattgctaga tcctctggaa gtgtcttttt acattttgtt ttatggtttt tgtttttgtt      6780
     tttgtttttt ttagactgtt tcactcttgt tgcccaggct ggagtgcagt ggcgccatct      6840
     gggctcactg caacctccac ctccaggatt caagagattc cccagcctca gcctcccaag      6900
     tagctgggtt actggctccc accaccacac tcggctaatt tttatatttt tagtagagac      6960
     agagtttcgc tatattggcc aggctgctct tcaactcctg acctcaagtg acctacccac      7020
     ctcggcctcc caatgtgctg ggattacagg catgaaccac tgtgcccgac ctcattttat      7080
     tttttgagga acttccatac tcttctcctc tgtaatggct gtactaattt acattcgtat      7140
     cagcagtgta ccagatgcaa ccctggttga ctcagcagag caagagacgt gcagtaagag      7200
     agaatttagc ttatttatgc acacgacact tccactcact cactcgttca gccaatgccc      7260
     catgctcagg ctgtgcagtg tggaatcttt tcctattgtt gccataacaa atttccacaa      7320
     gcttcgtgga tgaaaacatg tttttcttaa ttatctcaca gtgctgtaac tcagaagtat      7380
     gaactgcatt tcactgggct gatatcaaag ggacagtaag gctggatttc tttttaaggt      7440
     tccaagcaag aatctgctcc ttaacgtttc ccagctccta gaggctccca cgttcctggg      7500
     cccctggtcc ccttcctcct tcctccttcc tcaaagccca caaaggctgg tcacgtctca      7560
     catggcatca ttcagactct tcttctttac ccacaccttt ttctctgaat cctgctctgc      7620
     cttcttcctc atcttttaag gactttggga ttctattggg gtcaccaaga taatccatct      7680
     caatctccct aaaatcatcc agcgtaccct ctttttaagt tcagctgatt agcaaccgta      7740
     atgccatctg caatcttcat tcctcctttc ctgtaaaata acatattcac aagctatgga      7800
     ggctaagaca gggacatttt gggggtgggg cagcattctc ctgccttcca caaatggtaa      7860
     acaggatgca tttggcctct gctcttggga cgctgatatt gcagatgggt aaatgcgagg      7920
     gcagagaatg aatgcacaag ggtaccaata aatgaatgat ccattgggaa gcatctgtgc      7980
     accaaatctg gggttttttg tgtgtgtgtg ttttttttgt tttctttttt tttttgagta      8040
     gagtctctct ctgttccaca ggctggagtg cagtagcaca atctcagctc attgcaacct      8100
     ctgcctcctg ggttcatgca attctcctgc ctcagcctac cgagtagctg ggattacagc      8160
     tgtgcgccac cacactcggc taattttttt ggtatatttt tttagtagaa atgaggtttc      8220
     accatgttgt gcagcctgtc tcaaactccc aatctcaagt gatcccaccg ccttagcgtc      8280
     cctaagtgca aagattacag gcgagagcta ctgcgcccag ccaggattta aaataagtaa      8340
     tagataatgc tgagtatata atttcaggtg acagagaagg tctcactgat cagataatat      8400
     ttgtgacctt aatggaaaaa atggattcaa cccttggaag attggcggaa ggattttcca      8460
     cactgagctc tcagccgtga aggcacaaag gtggaaacat tcttagttca aggaagaggc      8520
     tctgcctcaa atgctgggaa tgaagtgggg agaatgacaa gacaactgta gagagatgga      8580
     gagcacactg ggtacacagg aaactaagga ggaacaagga gcgtgtgttt gatactcaca      8640
     gccattggat tcaactcaga gctaactagg aatccctacc tgattaatag tgaccgacat      8700
     gaaaataagg gaggcccagg tgcgtaactg gaatctagga gacggtggaa aaggcaattc      8760
     ccgccccact ggtgaaacgt agggttgatt tacacactaa atgaatgaaa gatggatata      8820
     agctatgctt gtgaggtaga atcatttgca gggagggctt gctgggtttg atttttccta      8880
     gtagtttaat ccttgtttca ttaatttctt tctgagatgt gttttttttc tacatctaaa      8940
     tcaatacctg gcagaggagc gatagacaca tgaggggtgg tgcaaatgaa gggacctagt      9000
     ataatataat atacaagact gtggatgggg gctcacacct gtaacccaac actttgggag      9060
     gccaaggcgg gtagatcact taagggtagg agtttgagac cagcctggcc aacatggtga      9120
     aaccccgtct gtactaaaaa tacaaaaatt agcctggtgc attggcacct gcctgtaatc      9180
     ccagcgactg gggaggctga agcagaagaa tggcttcaac cctggaggca gaggttgaac      9240
     tgagatcgca tcactgcact ccagcctgac acagggggac tctgtctcaa aaaataaaaa      9300
     taaaacatac ataattatga cacacagaaa ttacaaaggc aactggatac caaccatcat      9360
     ttttctattt ctctgtgttt aattctttga ccctttatct tatccattaa acaatcaggt      9420
     taaacctctt ccttatttgg ctttctgtga gcttgggatc atatggaaaa tgtgaaagcc      9480
     tcctgaaccc accagcacag gtcctggaat agagaacgtg ctctgttcat ggcataaaac      9540
     ttgccccttc acccaaatcc cccaattcat ctctacttcc aatcacctat ggagatacag      9600
     atagatcatg gggaggtaaa cactaatact ctttggagtg agctcagatc ttggactcag      9660
     agaccagtgc cagcactagc ccctggtcac atttcgtact aactcacaga aggacaggct      9720
     gtattgaaac aataaacgac ggagagggcg gtccttcccc gtgcttctcg ggtggaatag      9780
     cagcctaata tatgtctcag cagatcacaa aaagtagcat gttgttcctg ggctacatca      9840
     ttatttcatg gctgtttgat ttaagtcagt tctacttcac tttttttatc ttgatttcat      9900
     tttttctttc ttttcttgga gaatgtaatt tttttgagtc aagagggttg tggtggtaga      9960
     aactgtaaag cacattcgct gtgtatcaat cccaatccag tcttcccaga gaagactcta     10020
     aacacctcct ggaatgtacc tgggcctata ccaattccta tcactcaccg tcactccagg     10080
     gagacagaac acacagagaa cacattacac aggcaggttc attactaaca gataagcagc     10140
     gagtgacaac agaagcctac atttcaatgt gagccagtcc ctcaaggctc agaaaagctg     10200
     ctcgagacat gtggagtcac cccatatgca gtgtatctgg gggaaatcaa aaagcagccc     10260
     agcctgggtt ttgtaccctg gagccacagg aagcactcag ctaaagcact gcatgacgtc     10320
     ctcctccagg aagaacagga agacagccca ggctgttctg ggatgttcct cctgatctca     10380
     ggactttgct gtcttagtcc atttttgttg ctctaaagga acacttgagc ctgggtaact     10440
     tctaaagaaa agaaatgtgt ttgcctcaca gttctgcagg ctgtactgga agcatggcac     10500
     cagcatctat ttcttgtgac ggcctcaggc tgctcccgct ctggcagaag ggaaggaggg     10560
     tctatctgtg cagagaccac agagatcaca cggcaagaga gggagcaagg gggaggggga     10620
     gcgatggagc ttccaagttc tttttaacaa ccagctctcc aggaactaat agagggggaa     10680
     cttgctaacc ccatctcctt gggacagcat tgatctgttc atgatggatc cacctccatg     10740
     acccaaacac ctcccaagag gcccaacctc ccaccctggg ggttacattt caatgtgagg     10800
     tttgaagtgg tcaaacatct aaactaaagc agttgtatcc tcagcacgtt ctatggttac     10860
     tacaactgag aaagcaggag gaagctaggt ctcccgccat ctgggtgctt gtcctaaaga     10920
     gacgttgtat gtggttacct gtcaatcaag aaatgtgaga caattcatat agaggaactg     10980
     ctatgattag cttcttattg gtgtcttgtc ttcctccagg taactccaga tacctgcacg     11040
     ctctgattgg gacctcagtg gtcatcatcc cctttgctat cctcctcttc tttctccttc     11100
     atcgctggtg tgccaacaaa aagagtaagt ctcacgaagc agaagccaga gagctcaggg     11160
     ccatgtgggg aagcaggatg ggagcactca ggtgtgtgtt ccttacaggc aggatggtcc     11220
     ctgacccaag gcaggagcca cagaggcagg actttctaga gagagcacca gactccctgc     11280
     ccctgccttc agctcacaga ccattgcctg attctgaacc atatcctcac atcccctgca     11340
     gccactcaca tccaggagaa ggttccatga caggcagaaa gtgggagaca gaatcaatgg     11400
     gatgggaact cagagctatt catgggatgg gtccttgagc tcagagagat agaatgtctg     11460
     agtctgctgt tggcaactga gggacctcag gcacctatgg cctccccctg catgttggta     11520
     tctgcttatg aaatgaggac ccagaagtgc cctccgagct gttttgacga cttccgtctt     11580
     ctacagatgc tgttgtaatg gaccaagagc ctgcagggaa cagaacagtg aacagggagg     11640
     taggtgctcc tcagcccagc ctcatggcta gtcttattcc caaagagtcc tgaaaaatgt     11700
     gagcaccctc cctcactcag catttccctc cctccaggac tctgatgaac aagaccctca     11760
     ggaggtgaca tacgcacagt tgaatcactg cgttttcaca cagagaaaaa tcactcgccc     11820
     ttctcagagg cccaagacac ccccaacaga taccagcgtg taacacggaa cttccaaatg     11880
     ctgagcgcag atccaaagtt gtcttctgtc caccagcacc acagtcaggc cttgatggga     11940
     tcttctaggg agacaatagc cctgtctcaa aaccgggttg ccagctccca tgtaccagca     12000
     gctggaatct gaaggcgtga gtctgcatct tagggcatcg ctcttcctca caccacgaat     12060
     ctgaacatgc ctctctcttg cttacaaatg tctaaggtcc ccactgcctg ctggagagaa     12120
     aacacactcc tttgcttagc ccacaattct ccatttcact tgacccctgc ccacctctcc     12180
     aacctaactg gcttacttcc tagtctactt gaggctgcga tcacactgag gaactcacaa     12240
     ttccaaacat ataagaggct ccctcttaac acggcactta gatacatgct attccacctt     12300
     tcctcatgtt gttccacctt tcctcagagt atctttcagc cttctgtcag cagtaaaact     12360
     tataaatttt ttttataatt tcaatgtagt tttctattct tcaagtaaac atgtctgccc     12420
     tcat                                                                  12424
//