Dbfetch

ID   U95729; SV 1; linear; cDNA; STD; HUM; 954 BP.
XX
AC   U95729;
XX
DT   23-NOV-2012 (Rel. 201247-5, arrived in LIGM-DB)
DT   25-JUN-2015 (Rel. 201526-4, Last updated, Version 6)
XX
DE   Human MHC class I chain-related protein (MICB) mRNA, allele 2, partial cds.
XX
KW   Immunoglobulin superfamily (IgSF); RPI-MH1Like; RPI-MH1Like-Alpha;
KW   Major histocompatibility superfamily (MhSF);
KW   related protein of the immune system (RPI); conventional-with-leader;
KW   regular; cDNA; undefined; functional; L-nt-sequence.
XX
OS   Homo sapiens (human)
OC   cellular organisms; Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria;
OC   Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata; Teleostomi;
OC   Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota;
OC   Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates;
OC   Haplorrhini; Simiiformes; Catarrhini; Hominoidea; Hominidae; Homininae;
OC   Homo; Homo sapiens.
XX
RN   [1]
RP   1-954
RX   DOI; 10.1007/s002510050299.
RX   PUBMED; 9271635.
RA   Pellet P., Renaud M., Fodil N., Laloux L., Inoko H., Hauptmann G.,
RA   Debre P., Bahram S., Theodorou I.;
RT   "Allelic repertoire of the human MICB gene";
RL   Immunogenetics 46(5):434-436(1997).
XX
RN   [2]
RP   1-954
RA   Pellet P., Bahram S., Theodorou I.;
RT   ;
RL   Submitted (25-MAR-1997) to the INSDC.
RL   Laboratoire Central d'Immunologie, Hopital Pitie Salpetriere, Batiment
RL   CERVI 83 Bd de l'Hopital, Paris 75013, France
XX
DR   ENA; U95729.
DR   Ensembl-Gn; ENSG00000204516; Homo_sapiens.
DR   Ensembl-Gn; ENSG00000206449; Homo_sapiens.
DR   Ensembl-Gn; ENSG00000224378; Homo_sapiens.
DR   Ensembl-Gn; ENSG00000227772; Homo_sapiens.
DR   Ensembl-Gn; ENSG00000231179; Homo_sapiens.
DR   Ensembl-Gn; ENSG00000231372; Homo_sapiens.
DR   Ensembl-Gn; ENSG00000234218; Homo_sapiens.
DR   Ensembl-Gn; ENSG00000238289; Homo_sapiens.
DR   Ensembl-Tr; ENST00000252229; Homo_sapiens.
DR   Ensembl-Tr; ENST00000383514; Homo_sapiens.
DR   Ensembl-Tr; ENST00000399150; Homo_sapiens.
DR   Ensembl-Tr; ENST00000400313; Homo_sapiens.
DR   Ensembl-Tr; ENST00000427115; Homo_sapiens.
DR   Ensembl-Tr; ENST00000428059; Homo_sapiens.
DR   Ensembl-Tr; ENST00000428416; Homo_sapiens.
DR   Ensembl-Tr; ENST00000436531; Homo_sapiens.
DR   Ensembl-Tr; ENST00000436655; Homo_sapiens.
DR   Ensembl-Tr; ENST00000437651; Homo_sapiens.
DR   Ensembl-Tr; ENST00000438954; Homo_sapiens.
DR   Ensembl-Tr; ENST00000442104; Homo_sapiens.
DR   Ensembl-Tr; ENST00000443156; Homo_sapiens.
DR   Ensembl-Tr; ENST00000451603; Homo_sapiens.
DR   Ensembl-Tr; ENST00000451789; Homo_sapiens.
DR   Ensembl-Tr; ENST00000456351; Homo_sapiens.
DR   Ensembl-Tr; ENST00000458032; Homo_sapiens.
DR   Ensembl-Tr; ENST00000538442; Homo_sapiens.
DR   Ensembl-Tr; ENST00000546706; Homo_sapiens.
DR   Ensembl-Tr; ENST00000547574; Homo_sapiens.
DR   Ensembl-Tr; ENST00000548053; Homo_sapiens.
DR   Ensembl-Tr; ENST00000548353; Homo_sapiens.
DR   Ensembl-Tr; ENST00000549014; Homo_sapiens.
DR   Ensembl-Tr; ENST00000551608; Homo_sapiens.
DR   Ensembl-Tr; ENST00000551821; Homo_sapiens.
DR   Ensembl-Tr; ENST00000551950; Homo_sapiens.
DR   Ensembl-Tr; ENST00000551960; Homo_sapiens.
DR   Ensembl-Tr; ENST00000552701; Homo_sapiens.
XX
CC   IMGT/LIGM-DB annotation level: by annotators
XX
FH   Key                 Location/Qualifiers
FH   
FT   L-nt-SEQUENCE       <1..>954
FT                       /partial
FT                       /IMGT_allele="MICB*03"
FT                       /IMGT_gene="MICB"
FT                       /IMGT_map="6p21.33"
FT                       /IMGT_note="promoter of this allele is available on 
FT                       sequence AY683461"
FT                       /chromosome="6"
FT                       /db_xref="taxon:9606"
FT                       /functional=" "
FT                       /mol_type="mRNA"
FT                       /organism="Homo sapiens"
FT   L-CODING-REGION     <1..>954
FT                       /partial
FT                       /translation="EPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKR
FT                       RAKPQGQWAEDVLGAETWDTETEDLTENGQDLRRTLTHIKDQKGGLHSLQEIRVC
FT                       EIHEDSSTRGSRHFYYNGELFLSQNLETQESTVPQSSRAQTLAMNVTNFWKEDAM
FT                       KTKTHYRAMQADCLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASS
FT                       FYPRNITLTWRQDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYM
FT                       EHSGNHGTHPVPSGKALVLQSQRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAE
FT                       GP"
FT                       /db_xref="GOA:Q29980"
FT                       /db_xref="H-InvDB:HIT000222781.12"
FT                       /db_xref="HGNC:7091"
FT                       /db_xref="IMGT/HLA:MICB*002:01:01"
FT                       /db_xref="InterPro:IPR001039"
FT                       /db_xref="InterPro:IPR003597"
FT                       /db_xref="InterPro:IPR007110"
FT                       /db_xref="InterPro:IPR011161"
FT                       /db_xref="InterPro:IPR011162"
FT                       /db_xref="InterPro:IPR013783"
FT                       /db_xref="PDB:1JE6"
FT                       /db_xref="PDB:2WY3"
FT                       /db_xref="UniProtKB/Swiss-Prot:Q29980"
FT                       /protein_id="AAB71642.1"
FT   G-ALPHA1-LIKE       1..255
FT                       /translation="EPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKR
FT                       RAKPQGQWAEDVLGAETWDTETEDLTENGQDLRRTLTHIKDQKG"
FT                       /AA_IMGT="AA 1 to 86, AA 40 and 41 are missing, AA 54A 
FT                       is present"
FT                       /IMGT_note="encoded by EX3"
FT   G-ALPHA2-LIKE       256..543
FT                       /translation="GLHSLQEIRVCEIHEDSSTRGSRHFYYNGELFLSQNLETQE
FT                       STVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADCLQKLQRYLKSGVAIRRT
FT                       "
FT                       /AA_IMGT="AA 1 to 92, AA 17, 40, 41 and 87 are 
FT                       missing, AA 49.1 to 49.5, 61A, 61B and 72A are present"
FT                       /IMGT_note="encoded by EX3"
FT   SPLICE-FIRST-CODON  256..258
FT                       /splicing-frame="sf1"
FT   C-LIKE              544..822
FT                       /translation="VPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVS
FT                       LSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPS"
FT                       /AA_IMGT="AA 1.1 to 123, AA 14 to 16, 31, 34, 94 to 96 
FT                       and 110 to 113 are missing, AA 1.1, 45.1 to 45.6, 84.1 
FT                       to 84.4, 85.4 to 85.1 are present"
FT                       /IMGT_note="encoded by EX4"
FT   SPLICE-FIRST-CODON  544..546
FT                       /splicing-frame="sf1"
FT   CO-TM-CY-REGION     823..>954
FT                       /partial
FT                       /translation="GKALVLQSQRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAA
FT                       EGP"
FT   CONNECTING-REGION   823..858
FT                       /translation="GKALVLQSQRTD"
FT                       /AA_IMGT="AA 1 to 12"
FT                       /IMGT_note="encoded by 5' part of EX5"
FT   SPLICE-FIRST-CODON  823..825
FT                       /splicing-frame="sf1"
FT   TRANSMEMBRANE-REGION859..915
FT                       /translation="FPYVSAAMPCFVIIIILCV"
FT                       /AA_IMGT="AA 1 to 19"
FT                       /IMGT_note="encoded by middle part of EX5"
FT   CYTOPLASMIC-REGION  916..>954
FT                       /partial
FT                       /translation="PCCKKKTSAAEGP"
FT                       /AA_IMGT="AA 1 to 13"
FT                       /IMGT_note="encoded by 3' part of EX5 and EX6"
XX
SQ   Sequence 954 BP; 242 A; 255 C; 266 G; 191 T; 0 other;
     gagccccaca gtcttcgtta caacctcatg gtgctgtccc aggatggatc tgtgcagtca        60
     gggtttctcg ctgagggaca tctggatggt cagcccttcc tgcgctatga caggcagaaa       120
     cgcagggcaa agccccaggg acagtgggca gaagatgtcc tgggagctga gacctgggac       180
     acagagaccg aggacttgac agagaatggg caagacctca ggaggaccct gactcatatc       240
     aaggaccaga aaggaggctt gcattccctc caggagatta gggtctgtga gatccatgaa       300
     gacagcagca ccaggggctc ccggcatttc tactacaatg gggagctctt cctctcccaa       360
     aacctggaga ctcaagaatc gacagtgccc cagtcctcca gagctcagac cttggctatg       420
     aacgtcacaa atttctggaa ggaagatgcc atgaagacca agacacacta tcgcgctatg       480
     caggcagact gcctgcagaa actacagcga tatctgaaat ccggggtggc catcaggaga       540
     acagtgcccc ccatggtgaa tgtcacctgc agcgaggtct cagagggcaa catcaccgtg       600
     acatgcaggg cttccagctt ctatccccgg aatatcacac tgacctggcg tcaggatggg       660
     gtatctttga gccacaacac ccagcagtgg ggggatgtcc tgcctgatgg gaatggaacc       720
     taccagacct gggtggccac caggattcgc caaggagagg agcagaggtt cacctgctac       780
     atggaacaca gcgggaatca cggcactcac cctgtgccct ctgggaaggc gctggtgctt       840
     cagagtcaac ggacagactt tccatatgtt tctgctgcta tgccatgttt tgttattatt       900
     attattctct gtgtcccttg ttgcaagaag aaaacatcag cggcagaggg tcca             954
//