spacer

EBI Dbfetch

ID   HLA09025; SV 1; standard; DNA; HUM; 546 BP.
XX
AC   HLA09025;
XX
SV   HLA09025.1
XX
DT   31-DEC-2012 (Rel. 3.11.0, Created, Version 1)
DT   17-JUL-2014 (Rel. 3.17.0, Last Updated, Version 1)
XX
DE   HLA-C*05:87, Human MHC Class I sequence (partial)
XX
KW   Human MHC; HLA; Class I; HLA-C; Allele; HLA-C*05:87;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IMGT/HLA Release Version 3.17.0 - Updated 21-AUG-2014
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence for as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; JX842740; JX842740.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Unknown"
FT                   /cell_line="HG00005274"
FT   CDS             <1..546>
FT                   /codon_start=1
FT                   /partial
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*05:87"
FT                   /product="MHC Class I HLA-C*05:87 sequence"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAAEKAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKKTLQRA"
FT   exon            1..270
FT                   /number="2"
FT   exon            271..546
FT                   /number="3"
SQ   Sequence 546 BP; 112 A; 167 C; 197 G; 70 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcagttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgaac ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacac cctccagagg atgtatggct       300
     gcgacctggg gcccgacggg cgcctcctcc gcgggtataa ccagttcgcc tacgacggca       360
     aggattacat cgccctgaat gaggacctgc gctcctggac cgccgcggag aaggcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga gcagcggaga gcctacctgg       480
     agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaagaag acgctgcagc       540
     gcgcgg                                                                  546
//


spacer
spacer